Category Archives: greek

Greek fakeaway recipes

Standard

Posted by

Posted on

October 24, 2016

Posted under

fakeaways, greek, low syn, lunch, recipe card, savoury snacks, snacks, taster ideas, vegetarian

droptober recipe #16: greek garden omelette

Well, Droptober’s 31 recipes fell over, but hey, let’s at least try and aim for 20 eh? Shit or bust! Tonight’s recipe is greek garden omelette, but let’s dwell for a moment.

Ah, autumn. It’s finally arrived. You know how you know autumn has truly arrived? It’s really very simple – it’s not the leaves on the trees turning russet and golden, nor is the first icy chill in the air oh no, it’s when you first spot the first sharing of ‘MUSLIMS WANT 2 BAN THE POPEYE LIKE IF U THINK THIS ISA DISC RACE IGKNORR IF U H8 SIVILISA SIEVEISEYELISAT EVRY1′ on facebook.

cuhbpwawsaejy7o

Just for the record, this is a disc race. The word you’re aiming for is a disgrace, as in ‘I am a disgrace to my peers for sharing this hateful nonsense’. Twat. I’ve had my first one already this year. Don’t share hatred!

Anyway, not sure where that little nugget of anger popped from, as I’m actually feeling quite laid back. Apologies that we stopped posting for a bit but well, we’re busy folk and plus, in all honesty, it’s hard to eke out 700 exciting words about doing very little thanks to ear infections, busy work and house problems. Some random thoughts, though.

Paul pointed out that I must have come across as a right unsympathetic arse with the guy who comes around and cleans my car, and not least because the poor sod has to sit in a mist of my farts, Haribo wrappers and chest hair whilst he scrubs away at my accellarator and that weird second pedal in the middle that I have no idea what purpose it solves. See, he was supposed to be at ours last weekend and failed to turn up, leaving me seething and sighing dramatically to the point where Paul diagnosed me with COPD and put me on an oxygen feed. He texted a few hours later to say his mother had been taken into hospital, hence no contact, and I said it was fine, no worries, we can re-arrange. See, I’m not a complete bastard.

If I was a bastard I’d have driven to the hospital, unplugged her life-support and plugged in the little handheld hoover so he could give my gearstick bag a good suck, but I digress.

He turned up yesterday full of unnecessary apologies and set to work. I asked if he wanted a coffee to keep him warm then promptly forgot about it and went about my business. It was only after spotting him looking forlorn across the garden that I remembered and hastened out with a piping cup of the Blue Mountain that we keep for guests. However, Paul pointed out afterwards that I’d served his coffee in one of our Modern Toss cups, namely the one that says “I don’t feel like turning up for work today, so fuck off”. I hope he doesn’t think I’m being passive aggressive and refuse to polish my rims. Just once I’d like a workman to leave this house and actually want to come back.

Ah! You know how people always say there’s never a policeman around when you need one? Well, after five years of driving, it finally happened for me – I was beetling along a dual carriageway in the right hand land, unable to pull over into the left lane as there was slower traffic, when some wankstain in a Vauxhall Insignia came so far up my arse that I almost unrolled a condom as force of habit. He was doing the usual – giant hand gestures, yelling incoherently, wanker signs – I’m not sure if he had realised that I literally couldn’t go anywhere as my DS3 was unlikely to squeeze into the passenger seat of the Fiat 500 to the left of me. Cock. I drove on, keeping to the speed limit and putting my hand on my chest and shaking my head ruefully in a very British ‘what am I like’ gesture, which only served to make him angrier.

However, once I could get over, I did move over, not least because his face had turned into a mewling over-ripe strawberry at that point and I didn’t want the fucker to stroke-out and need mouth to mouth by the side of the road. I rather expected his lips would taste of sweat, cheap cigars and Lynx Atlantis. He sped past, gesticulating all the while, and I promptly forgot about him, the very same way I imagine all his friends and family do at a social occasion. Five minutes later, at the end of the dual carriageway, there he was getting talked to by a very butch looking policeman. Ah, lovely. I made absolutely damn sure I slowed down as I went past but didn’t manage to catch his eye – however, he saw me on my fourth trip around the roundabout, and I was sure to give him the tinkliest, most coquettish little way as I trundled past.

Finally, it’s been a while since we discussed the neighbours and that’s for a good reason – all bar one have turned into decent human beings. We still have the one who won’t talk to us unless he’s blowing spittle in our face and complaining about our cats, but then he’s also the one who bemoaned to our other neighbours that having two gay men on the street would bring the house prices down, so you can imagine how much we value his opinion. Everyone knows that having a gay couple only improves the house prices because there’s no screaming children kicking about and well, we’re hardly likely to put a trampoline on our immaculate lawn, are we? The stupid fart.

Anyway, the reason I mention the neighbours is that we’re coming up to Christmas cards buying time (sorry!) and we still haven’t solved the problem from last year – we realised that we have a couple called Pat and Les on the street but no fucking clue which is which. I know it doesn’t matter but I hate not knowing, not least because they’re decent people and always make a point of saying ‘morning James, you’re looking slim’ or “sorry Paul, can you come and retrieve your car, a slight gust has blown it into our lobelia”, to which I can only stutter and say ‘howdo…my love’ or similar. Is it Patrick and Lesley? Patricia and Les? Bah. At least we know what to call the homophobic neighbour, although, as he’s deaf, he’s must be mystified as to why we call him a Count as he walks past scowling at our cats.

Speaking of gardens, let’s get to the greek garden omelette I promised you earlier!

greek garden omelette

to make greek garden omelette you will need:

  • 10 eggs
  • 1 large red onion, cut into wedges
  • 3-4 tomatoes, cut into large chunks
  • 130g reduced-fat feta cheese (2x HeA)
  • handful of black olives (about 20-ish – 4 syns), sliced in half
  • handful of rocket leaves
  • pinch of salt and pepper

The joy of an omelette is that you can customise it however you want – throw in some sliced sausages, ham, mushrooms, cigarettes or a small motor car. It’s YOUR dinner. This makes enough for four. You will need a pan that can go into the oven – we use this, but you can get cheaper!

to make greek garden omelette you should:

  • in a big bowl, whisk together the eggs with the salt and pepper
  • preheat the grill to high
  • heat a large frying pan over a high heat and add some oil (use one of these and save your pans!)
  • chuck in the onions and fry for a bit until softened and beginning to brown
  • add the olives, rocket and tomatoes and cook for a few minutes more until softened
  • reduce the heat to medium and pour in the eggs – stir frequently whilst they’re still runny and until the mixture is half-set – this will only take a couple of minutes
  • sprinkle over the feta cheese and put the pan under grill and cook for 5-6 minutes until puffy and golden

Enjoy! For more ideas, click any of the buttons below!

poultrysmallbeefsmallporksmalllambsmallfakeawayssmallpastasmallvegetariansmall sausagessmall  seafoodsmallbreakfastsmall

J

Standard

Posted by

Posted on

October 14, 2016

Posted under

american, fakeaways, greek, low syn, lunch, mince, poultry, recipe card, savoury snacks, snacks, taster ideas

droptober recipe #13: spinach and feta stuffed meatloaf

Yeah yeah, spinach and feta stuffed meatloaf will follow, but see, I am FURIOUS. Well, maybe furious is over-selling it, I’m a bit peeved – we were doing so well with the old Droptober business and then oops, technical problems abound, and we missed a day. Ah well. If you’re out there sobbing into your fifth cheesecake of the day and barely able to breathe due to the Rolos stuffed up your nose, you can blame me. Or the good folks at WordPress. I’ll post two recipes tomorrow to make up for it, and, if that doesn’t cut the mustard, I’ll strip off and whip my back with a few Curly-Wurlys melted together. I’m like Jesus Christ but in elasticated Cotton Trader trousers.

I’m going to tell you a quick story about Paul which has been on my mind all day. I can’t recall mentioning it on the blog when it happened but see, he’s switched to a new employer and a new job and thus I feel we can get away with mentioning it without him getting into mischief. See, he used to work in a very serious area of social care and part of that meant attending very important, very serious meetings with doctors, the police, social workers, judges and lawyers all sat around a table. Due to the nature of what they were discussing it was mandatory for the meeting and everything that was said to be video-recorded, and this was done by several small cameras on the desk which would automatically pivot to whoever was talking. All terrifically serious and no jokes allowed.

Naturally, Paul managed to make an absolute tit of himself. See, he dropped his papers. That’s fine, but Paul spends about 96% of his working time tucking his shirt back into his trousers so no-one sees the top of his arse. He’d forgotten to do that, meaning he had to awkwardly crouch down to get his papers rather than mooning all the very ashen-faced folk around the table. And, because he was tense and trying to bend awkwardly, he let loose with a fart that didn’t so much echo around the room as fucking gallop around the table. That in itself wasn’t so bad, but the whole moment of crushing embarrassment was punctuated by the sudden and accusatory whirr of all the cameras immediately spinning and pointing at the cause of the sound. His cheeks weren’t red, they were slightly browned and smelling faintly of last night’s Mongolian beef.

At this point, had everyone collapsed into giggles and chortles (though, more likely spluttering and choking, with people flinging themselves at the glass windows in the hope of sweet escape), the tension would have been relieved, but no. No, everyone shuffled their papers, cleared their throats and cracked on, leaving Paul to burn away merrily with shame and anguish. His boss did ask on the drive back to the office whether ‘anyone had heard an unusual noise’, bless, but everyone knew it was him. I blame myself – the beef was two days out of date.

Luckily, I’ve never had to endure such acute embarrassment, though I’m prone to making a tit of myself, it’s always low-level stuff. For example, I can’t make small-talk with male cashiers without it sounding like I’m leading them on or being plain weird. There’s a young guy in our local Tesco who, bless his heart, could see both ends of a bus coming as it came round the corner. He’s absolutely not my type. It doesn’t stop me feeling I have to be ‘nice’ when he’s helping me in the self-scan – last time I was there I asked who did his tattooes as they ‘looked really nice’, which instantly gave the impression I’ve been leering lasciviously at this bloke. He went pink, I went red and he forgot all about the security check and pushed my trolley through. Perhaps that’s the key to shoplifting – as soon as you approach the Scan ‘n’ Shop bit just wink at the guy standing looking serious, paw at his arse and go ‘OOOOH CUT ME OFF A SLICE OF THAT’. Or, don’t.

I’m forever mis-spelling words in emails (signing off with kind retards, asking accunts to sort out expenses) to the point where I can’t send an email without triple-checking things now, which is unfortunate when someone needs an answer straight away and I have to check to make sure I haven’t slipped bumfucker into my ‘next steps’ paragraph. Oh, there was one time I managed to embarrass myself to the point where the air in my throat chokes me even now as I think about it – way back in high school my lovely form tutor sat us all down at the start of the year and told us she had some important news – her husband had hung himself over the summer holidays. Awful, of course, absolutely awful. But see, I just can’t handle solemn silences, I get so anxious and stressed that it manifests itself into giggles and tics. Of course, I laughed, and I swear to God, I’ve never apologised to anyone more in my life since that moment. I remember masking it as a coughing fit but that just made it worse.

I’m not a complete bastard, please don’t judge me. It’s 100% involuntary and since that moment I’ve gone out of my way to remove myself from situations where people tell me sad news. Hell, I’ve only been to three funerals in my life and even at my nana’s I almost burst out laughing because I imagined her hearing aid still whistling away in the coffin like a distant fax machine. My aunt and uncle died at the same time when I was a teenager and I was probably the only person in that church simultaneously crying and balling my fist into my mouth to stop the laughter – to be fair, they brought out the second coffin and set it down on a trestle table with very wobbly legs, giving me visions of the whole thing giving away and tumbling his corpse down the aisle. What can I say, I love a bit of slapstick.

Anyway, I can barely type because I’m cringing so much I’m getting neck-ache. Let’s deal with dinner, shall we? This makes enough for four and you’ll need a smallish loaf fin!

spinach and feta stuffed meatloaf

to make spinach and feta stuffed meatloaf, you’re going to need:

  • one 500g pack of turkey mince – normally 2% fat, so syn-free
  • 130g of reduced fat feta – two people’s worth of a HEA
  • one HEB breadbun – 60g
  • 25 of Tesco Ingredients sundried tomatoes – these are dried ones rather than done in oil – you simply hydrate them in water beforehand – or use sundried tomato puree, or leave it out, hey, listen, you don’t need me telling you what to do
  • that’s a fib, you totally do, should we agree a safeword?
  • two big red onions
  • four cloves of garlic
  • one or even two large bags of spinach, depends how much spinach you like – I like loads and you’ll note that when you boil down two large bags of spinach, it’ll wilt down to approximately the volume of a postage stamp
  • one large egg
  • one egg white from another large egg
  • pinches of salt, pepper, basil if you have it, oregano if you have it
  • any name-brand passata, let’s not be fussy

to make spinach and feta stuffed meatloaf, you should:

  • chop the onions nice and finely and gently cook them off in a pan with a few sprays of oil
  • remove the onions into a bowl
  • add the spinach into the pan and let it wilt right down
  • once wilted, take the spinach and squeeze every drop of water you can out of it

Here’s a top tip from us: use a potato ricer to squeeze the water of spinach in no time at all. Potato ricers also make amazing mash, but this is a brilliant use for it – you can buy one by clicking here – and they’re nice and cheap! 

  • add it back into the pan, just off the heat, add the minced garlic, crumbled feta, sundried tomato and the egg-white and stir to mix it all up with a load of black pepper
  • put that to one side and let’s start building the meatloaf – stick the oven onto 170 degrees
  • tip the turkey mince into the same bowl as the onions – add the breadcrumbs, egg, pepper, bit of salt, basil, oregano and then really go to town mixing it all up – don’t be shy, pound away at it, get it all mixed up
  • if it is still a bit wet, add more breadcrumbs, but remember to syn them – I didn’t need extra breadcrumbs though
  • pop a few sprays of oil into a loaf tin and then shape the mince along the bottom and up the sides, saving some on the side to make a lid
  • spoon the spinach and cheese mix into the middle and then form a top over the spinach to create a full seal
  • hoy it in the oven – after thirty minutes, add a glaze over the top of some passata, then cook for another forty minutes or so until the meat is cooked
  • turn it out, leave to cool, slice it after ten minutes and serve with your sides
  • done!

Feel free to swap the turkey mince for beef or pork mince! Right, if you want more ideas, click the buttons below and, look, we’ve got lots more meatloaf recipes:

poultrysmallbeefsmallporksmallfakeawayssmallpastasmallvegetariansmall

Cheers!

J

Standard

Posted by

Posted on

October 26, 2015

Posted under

cured meats, fakeaways, fast food restaurants, greek, kebab shop, low syn, persian, pork, pork mince, recipe card

pork and chorizo kebabs

EMERGENCY RECIPE ACTIVATE (Paul and I are gallivanting!). This is super quick to make and a good way to use up pork mince – pork is a slightly drier mince so works well with the oily chorizo but beef could be used too. 

pork and chorizo burgers

to make pork and chorizo kebabs, you’ll need:

  • 500g lean pork mince
  • 75g chorizo, chopped (7.5 syns)
  • 5 cloves of garlic, chopped finely
  • handful of chopped parsley

This makes enough for six ‘burgers’, which you can chop up and put into a kebab or indeed, have as a burger. I think that’s enough for three people. If you’re finding that there’s too much meat for you to handle and you’ve got a badly-packed kebab, just take a bit out and try again. You’ll get the hang of it and there’ll be thick yoghurt sauce everywhere in no time at all.

to make pork and chorizo kebabs, you should:

  • mix together all of the ingredients and season to taste
  • divide the mixture into six and press into burger shapes
  • heat a large frying pan over a medium-high heat and place the burgers in the pan
  • cook for about 6-7 minutes each side, making sure the burgers are fully cooked
  • serve in a pitta bread (make sure it’s suitable for your HEB) with salad and raita (mix fat free yoghurt with chopped mint and shredded cucumber)

So easy!

J

Standard

Posted by

Posted on

October 16, 2015

Posted under

classics, fakeaways, greek, lamb, lamb mince, quark, recipe card, speciality ingredients, syn free, travel

slimming world moussaka

Good evening. Hey, it’s been a while since we chatted, just you and me. Well, that’ll have to wait – The Returned is back on TV tonight and I can’t wait to get a glimpse of that Frenchman’s knob lose myself in the mysterious world of the returning dead and impossibly pretty girls saying ‘Poob’. Ah yes. Paul is making moussaka, so I’m simply going to write until either a) it’s 9pm or b) my shoulders hurt or c) Paul forgets to bring me my hourly coffee and I have to set about his face with a claw hammer. He’s in good spirits today because he’s left his job – don’t get me wrong, he loved it, but it’s a new adventure see? I’ll touch on that another time because tonight I want to chunter on about our holiday. Can I remember the details? Of CORSICAN. It’s exactly that level of shit-hot humour you bloody love.

The last time I wittered on about Corsica, I told you about how lovely the villa was, how appalling my French was and how I managed to make a complete tit of myself in the middle of a French supermarket only to be shouted at and admonished by a merrily-whiskered lady behind the till. I’m not going to write chronologically about what we did going forward because frankly, we spent an awful amount of time sitting around doing nothing other than eating bread and relaxing in the sun.

That was my first downfall. See, I managed to burn myself in the sun. I’m always so careful to protect myself against the sun (health anxiety, remember), and despite previous times when I’ve turned myself blue by applying too much sun-screen, I slicked it on with gay abandon. Listen, I’m a Geordie – we don’t do bronzed and golden, we do either Philip Schofield’s hair white or alarming-boil-red. There’s no middle ground. I’m a big guy and I take a lot of sunscreen to cover me (I did think it would be quicker to use one of those hoses so dramatically employed in decontamination chambers) but I thought I had it licked. Nope. After three hours of merrily splashing around in the pool and sizzling gently on the sun-lounger, I noticed that my right buttock was a trifle sore.

This isn’t uncommon – I use my bum-cheeks most of the day, so a little tenderness can be expected. Normally Paul just needs to tilt me to relieve the pressure. But no, this was a more serious pain – I had managed to half of my arse a charming post-box red. You genuinely don’t realise how much your arse touches something until it feels like it’s been pressed against the door of an industrial kiln for a few moments. Every sit was uncomfortable, every walk a mixture of chaffing and sadness. Plus, in my mind, my arse now resembled a block of Neapolitan ice-cream, only far less delicious. Paul had to spend five minutes gently kneading my buttocks with after-sun to bring comfort – it may have looked slightly erotic if it wasn’t for me yelling that he was catching my arse-hair in the metal clasps of his watch.

Now now, don’t get preachy, most men have a hairy button, it’s just a fact of life. Paul was once climbing naked into the shower when I ran into the bathroom and clipped a clothes peg to his bum-hair for a laugh. I managed to just nip his sphincter in the peg mechanism. Well, honestly. I’ve never heard him scream so loud – there would have been a less dramatic response had I shot his foot off with a sawn-off shotgun. He didn’t speak to me for the rest of the day and it was only after I bought him a 1kg bar of Dairy Milk from Amazon and allowed him to delete all my favourite programmes from the Sky Planner that his frostiness melted. 

That was me injured. Paul’s turn now. Dotted around the pool were three metal ‘hammocks’ which were shaped like open metal balls suspended from a frame. You can see them here:

Casa_Julia_LowRes_Sept14_SH_02 (1)

Lovely yes? I declined to get into them as I was worried the chain would snap under my weight and well, I hate to hear metal scream, but Paul is lighter and more daring so flung himself into one with gay abandon. As if we could manage any other kind of abandon, dearie me. He swung around for a bit until he realised he was going to struggle to get out, given he’s only got little legs and the ball shape didn’t lend itself to an easy exit. I watched as he valiantly declared he’d found a way off only to swing the entire frame over and land, quite literally, flat on his face, with the frame of the hammock smacking his on the back of the head a moment later. I couldn’t tell if the loud ‘ooof’ came from me, his mouth or the air escaping from his fat, but it was hilarious. Me being a conscientious, kind-hearted husband couldn’t do a jot for laughing – indeed, I laughed so much from the deep-end of the pool that I almost drowned myself (that’ll teach me) and he lay for a good few seconds before laughing and moving. I’d be a shit paramedic – anything faintly slapstick and they’d be declaring death whilst I stood around slapping my knees with merriment. Perhaps it was karma from when something similar happened to me in Dobbies – we just don’t do well with hammocks.

Once we’d wiped the tears from our eyes (mine tears of laughter, his tears of blood and ocular fluid) we took a moment to decide what to do and decided on a spot of lunch. I was clearly so upset and fraught with the worry that Paul’s skull was filling with blood from his massive internal injury that it was really all I could do to take myself off for a long shower whilst Paul set about cutting up cheese and putting rocket in a bowl – well, it makes it easier to scrape into the bin later on. It was just as Paul was bending down (naked, remember) to get something from the crisper drawer when our rep appeared at the open living room door with a loud ‘HELLO’. Paul, mortified, spun around on his heel and clutched a tea-towel to his genitals (the same tea-towel I later saw him cleaning my wine glass with – which explains why I wondered if we were having Brie with our sauvignon blanc later on). Paul doesn’t do exhibitionism (even though he should, because he’s lovely), unlike me. I’m not fussed when I’m on holiday, I’ll cheerfully flop it out if it saves me carrying my swimming knickers to the beach.

I don’t swear ‘swimming knickers’ I hasten to add, I just like how that sounds in my head’.

What followed (I had taken a moment to stop murdering Cher’s greatest hits in the shower in order to gleefully listen) was a toe-curling exchange where Paul, frozen behind a breakfast bar with only a tea-towel and a packet of Pringles to hide his modesty, had to exchange polite conversation about how to turn off the pool alarm and where to leave the towels whilst the rep looked absolutely everywhere but his body. The rep was lovely mind, don’t get me wrong, and he had the good grace not to shout ‘YOU’RE NOT SUPPOSED TO LET CATTLE IN’ to me as I came out of the shower towelled and pleasant. He then explained that as a gay nudist he had seen it all before, as though Paul was some spectacle designed to be peeped at through a hole in the door. In another world it may have been the beginning of a raunchy Xtube video but not ours – Paul was so shocked and frightened that he had to have half of my sandwich just to calm down. 

I appreciate that this reads like some campy seventies farce but, as Mags is my witness, it’s the truth. Worst part of it all? Paul was so distracted by not accidentally showing the rep his lid that he paid no attention as to how to turn off the pool alarm, and MAN was that alarm sensitive. Each morning we’d be woken by it screeching away if a leaf tumbled in or a water-molecule split. I swear I sighed once in bed at the other end of the villa and it was away, wailing and blaring like a rape alarm. Our poor neighbours. Whilst we couldn’t see anyone nearby – it was forest that surrounded us – we knew there were people close-by by the laughter and sound of cars crunching over gravel. Knowing us, we were probably perched at the end of a housing estate or a nursing home and several dozen Corsican families were being treated daily to the sight of our naked buttocks (mine a fetching red) as we climbed in the pool. Ah well. Not like we’ll ever see them again. 

Final tale before I sign off for the night. We did a very British thing indeed. Perhaps not British, actually, but rather the domain of the bone-idle. We decided halfway through the holiday to have a trip along the island to the port town of Bastia, a good three hour drive away (taking into account Paul’s need to stop every thirty minutes for a dump as we entered somewhere new). We planned the route the night before, made a couple of sandwiches for the car, set the alarm – all ready. We were in the car and making excellent time by around 8am. We’d researched local museums and excellent restaurants to try on our day out, oh what a lovely day. Hmm. The reality of it was that we drove for three hours and then couldn’t find a parking space. Not one. The French seem to park their cars like they’re dashing into maternity wards and haven’t a moment to lose. Every side street is an obstacle course of Corsican Corsas, with cars parked parallel, flush and across the road. I couldn’t understand it and the rage built up in me to such an extent that I yelled ‘WELL FUCK THIS’, did a 76 point turn in the middle of a one-way street and immediately revved the hell out of Bastia. Bastia? More like BASTARD. 

It might have been a lovely town full of curios and wonder, but all we saw of it was the back of a tour bus and the interior of a very large supermarket where we stopped for a calming round of bread and cheese. We’d managed the equivalent of driving to Durham from London, stopping at a Tesco Extra, buying a loaf of bread and driving home. The drive home was fairly silent – Paul slept, and I spent most of the time with my eye twitching and a renewed dislike of the world.  I did switch the radio on but frankly it sounded like I’d tuned into a cockfight so that was snapped off in anger too. 

I was at least reassured that when recounting this tale to a friend that she had done exactly the same, right down to the stopping at the supermarket on the way back. Phew.

We’ll leave it there. French Zombies are here. Before I go, tonight’s recipe is a Slimming World friendly moussaka. You’ll enjoy it! Bit of a clart on making it, no fib, but it’ll be tasty. Serves 4. You could make it with beef mince – lucky we chuck in three big bags of extra lean in our Musclefood deal, found RIGHT HERE (and don’t worry, it opens in a tidy new window so you won’t lose me forever).

slimming world moussaka

to make slimming world moussaka you’ll need:

  • 500g of extra lean minced lamb if you can find it – our butcher does lean lamb and we use that, but they also sell it in Tesco
  • 60g of extra mature cheddar, grated (2 x HEA)
  • 500g pasatta
  • 2 medium aubergines, cut into slices and dipped into lemon juice to stop them going brown
  • a couple of large potatoes
  • 1 bog standard carrot, diced finely
  • tin of tomatoes
  • 1 courgette, diced finely
  • 1 white onion, finely chopped
  • 2 fat cloves of garlic, crushed and minced (yep: USE ONE OF THESE MAN, YOU’LL SAVE SO MUCH)
  • 1/2 tsp of ground chilli, 1/2 of cinnamon, 1/2 of rosemary if you can find it, 1 tsp of oregano and 1 tsp of thyme
  • pinch of salt and pepper
  • beef stock made from a decent stock cube
  • half a tub of bloody Quark
  • 2 tbsp of fromage frais (make sure syn free else Maggie May will be livid)
  • bit more cheese, just to make it nice

and then to make slimming world moussaka you should (deep breath):

  • actually, look, it isn’t so bad, so get on with it
  • peel, slice and par-boil the potatoes until they are soft with a hint of rigidity, like a randy old bloke’s schlong;
  • take your slices of aubergine and stick them up yer arse and grill them in a fancy griddle pan or normal pan until they’re charred
  • hoy a bit of salt on them
  • cook your onions in another pan until soft, then add everything else in – mince, spices, garlic, courgette, stock etc – and cook for thirty minutes low and slow until it’s really thick;
  • whilst doing that, beat together the Quark, fromage frais, some cheese, salt and pepper and the yolk of an egg into a thick pale yellow sauce
  • assemble – mince mixture, then aubergine, potato, bit of white sauce (fnar fnar) rinse and repeat – you might not get many layers if you have a big dish, but so what? Just do what you can
  • throw cheese on the top and put in the oven for around half an hour, making sure it doesn’t burn
  • add more cheese at regular intervals until you’re satisfied and smiling
  • serve!

Coo, I’m knackered.

J

Standard

Posted by

Posted on

July 17, 2015

Posted under

breast, fakeaways, greek, lunch, poultry, recipe card, salad, savoury snacks, snacks, syn free

gyros and roasted veg

‘ello ‘ello.

No post last night because I was quizzing it again with the rabble – after deciding that ‘Bender and the Jets‘ was a cursed name, we switched it up and called ourselves ‘Puff and Bluster‘. We came mid-table, which wasn’t very nice for the barmaid to clean up. Use a dab of bleach love, it’ll thin it out. The best name of the night goes to ‘Quizlamic State‘ followed by ‘The Mad Twatters‘.

Next week we’ll be ‘Bruce Jenner-talia’ (of course) and then the ‘Menstrual Cycle Display Team’. Apparently calling ourselves ‘I wish this microphone was a big throbbing cock’ isn’t allowed as it would make the Quizmaster blush when he was reading out the scores. He’s a poor sport, not least because he doesn’t get dressed up like the Quizmaster from Sabrina.

Damn, I miss Sabrina. We had a black cat when I was growing up called Salem, who managed to sleep through being on fire. We had a coal fire and it would spit out sparks all the time – one such spark landed in his fur as he dozed in front of the fire, and we only realised what had happened when a flame appeared on his back and the air was thick with the smell of burning cat. We hastily threw a cup of tea (warm) at him, dabbed him out, and he just went back to sleep happy as larry. Not quite as dramatic as the time I threw a packet of cheap cigarette lighters on ‘to see what happened’ – let me tell you, it was like Hiroshima. He went on to live a long, uneventful life save for when he went missing for three months and returned with his hair so matted around his arse that we had to use a set of hair-clippers to get rid of his shitty tagnuts. We threw out the clippers afterwards. Hey it was unending glamour in our household!

Remember me waffling on a while ago that we’re active members of the Reddit Gift Exchange, where you send a random stranger (well not entirely random, they sign up for the service) a themed gift and another random stranger sends you something? It’s like a global secret santa and it’s GREAT fun. Hell, even I’m happy to take part, and I’m tighter than a astronaut’s arsehole. Anyway, this month’s theme was cookbooks, and we sent some nice Thai cookbooks off to a lovely lady down in Dorset and today we came back home to find a nice parcel waiting on the side. I say on the side, the cat had clearly decided the best place for it was on the kitchen floor so he could sleep on it. Which he did.

Turns out not only did we receive a charming Ching Chinese cookbook (her name, not me being all Bernard Manning) and a guide to Mexican food, but also – and I really think this is brilliant – a load of personal recipes that our Gifter had typed out and put in a binder for us! A mix of Scandinavian recipes that they’d found and even better, a collection of their own personal recipes! On top of that, a handwritten note saying how much they loved our blog (oh you!). I genuinely adore it – you all know how cynical I am – someone could give me a bunch of flowers and a cuddle and I’d be thinking is that they were trying to set off my hay-fever and/or bugger me – but this really touched me! IN MY SPECIAL PLACE. Thank you – massively – Jenny and Fox! We’re going to plan a Scandinavian themed week using your recipes as a thanks! 😀

GASP I’m all emotional. Let’s get some bloody dinner down wor pie-holes shall we. We were going to make pizza pies just to continue the theme of trying out what every fucker else is making but after the ‘sumptious’ steak bakes I really can’t be persuaded to try it. Perhaps I’m a little jaundiced by seeing 856 badly-focused photos of the bloody cheesy crusty things littering my facebook feed. Seriously my wall looks like a Google Streetview-tour of a burns unit.

So, Paul’s made gyros and roasted veg!

roastedveg chicken gyros

you’ll need these (makes easily chicken gyros enough for four)…

chicken gyros

  • 1kg diced chicken
  • 3 garlic cloves, crushed
  • 3 tsp white wine vinegar
  • 3 tbsp lemon juice
  • 3 tbsp fat free greek yoghurt
  • 1½ tbsp oregano
  • 1 tsp salt
  • ½ pepper
  • 4 BFree Multi-grain gluten-free wraps (HexB for one)

roasted mediterranean vegetables

  • 800g potatoes, cut into chunks
  • 1 aubergine, sliced and quartered
  • 1 red pepper and 1 orange pepper, deseeded and cut into chunks
  • 1 red onion, cut into chunks
  • 2 tbsp balsamic vinegar
  • 1 tsp mixed herbs
  • 4 garlic cloves, finely chopped

tzatziki

  • ½ cucumber
  • 250g fat-free natural yoghurt
  • 1 tsp white wine vinegar
  • 2 tsp lemon juice
  • ½ tsp salt
  • pinch of black pepper

salad

  • 3 tomatoes, diced
  • 1 cucumber, diced
  • 1 red onion, diced
  • handful of mint leaves, chopped

and you’ll need to do this…

  • firstly combine all of the ingredients for the gyros (minus the wraps) into a large bowl
  • cover and leave to marinate for at least two hours
  • next, prepare the tzatziki – cut the cucumber in half lengthways and scoop out the seeds
  • grate the flesh into a bowl and discard the skin
  • add the rest of the ingredients and leave to rest for at least twenty minutes
  • next, prepare the mediterranean vegetables by mixing together all of the ingredients
  • spread out onto a single layer in a roasting tray, spray with a bit of oil and place in the oven at 190 degrees for around forty-five minutes
  • whilst that’s cooking, mix together the salad ingredients and set aside
  • when you’re ready, spread out the chicken onto a single layer and cook under a medium-high grill until well cooked, turning regularly
  • finally, assemble your gyros by spreading the chicken, tzatziki and salad onto a wrap and roll

SEE IT’S THAT EASY.

J

Standard

Posted by

Posted on

June 14, 2015

Posted under

bacon, fakeaways, greek, lunch, persian, pork, pulses and grains, recipe card, savoury snacks, snacks, syn free, taster ideas

rainbow bulgur wheat salad with bacon and feta

Very quick post tonight as I’m going to work (hooray) to do overtime (hooray) and we’ve still got all of our boring, humdrum Sunday chores to do – such as watching Judge Rinder, playing Trivial Pursuit and ignoring our ironing. Slight moment of excitement when a police van came tearing into the cul-de-sac before, displaying a flagrant disregard for the neighbourhood SLOW CHILDREN sign, which I’ve always thought was a very apt description of the snotty-faced little life-leeches that occasionally visit. Of course everyone was immediately up out of their armchair peering through their nets to see what the deal was. Tsk. So nosy. I of course had to take that moment to immediately nip into the back garden and try to listen in hang out the washing. I didn’t hear anything and no-one was arrested.

Upon my return, Paul pointed out that I’d dashed into the back garden in such a rate of knots that I was still wearing my Spongebob Squarepants onesie from ASDA, plus it was drizzling so not exactly outside drying weather – hardly the most subtle of moves. Ah well. I’m too fat to be subtle. Here’s today’s recipe – it tasted amazing considering it’s such a simple mix of ingredients. It would package up nicely for an office lunch so why not make double and take a few extra portions in throughout the week? Urgh I sound like Delia Smith or something. Don’t worry, I awkwardly shoehorn in a reference to ejaculate in the recipe, so we’re alright.

You could easily omit the bacon  from this salad recipe and go veggie. But I mean, we’re not animals here.

rainbow salad

you’ll be needing these:

  • 4 large sweet potatoes, cut into small 1cm cubes
  • a couple of drops of olive oil
  • 3 tsp of paprika
  • 1 tsp of salt
  • 1 tsp of cumin seeds
  • 250g of bulgur wheat (substitute couscous if you prefer)
  • Zest of one lime
  • 1 tin of red kidney beans
  • handful of chopped coriander, but feel free to leave this out if like me you think it tastes of soapy balls
  • 1 tablespoon lime juice
  • a bunch of spring onions – cut up the green part as well as the white
  • 6 bacon medallions
  • 65g of reduced fat feta (cut into tiny cubes)

and you’ll need to do this:

  • preheat the oven to 220 degrees celsius
  • in a bowl mix together the potato cubes, 2 tsp paprika, cumin seeds and salt with a drop of olive oil (or Frylight if you prefer) and toss (the potatoes) until the potatoes are evenly coated
  • spread the potato cubes out onto a foil-lined baking tray in one layer and bake for twenty minutes – turning halfway
  • meanwhile, heat a large saucepan over a medium heat
  • add a teaspoon of olive oil (or Frylight, if you prefer) and add the bulgur wheat
  • leave for a few minutes, stirring regularly until it starts to crackle just very slightly
  • add the lime zest and lime juice and 500ml water
  • bring to the boil and add a little salt to your taste
  • reduce the heat and cover the pan so the mixture simmers for about twenty minutes or until it’s cooked through
  • chuck your bacon medallions under the grill to cook, then slice into little strips
  • cut your feta into tiny cubes
  • drain the kidney beans and rinse well under running water, getting rid of all that gunky kidney-bean pre-cum you always get from tinned pulses
  • place the beans in a bowl and sprinkle with a teaspoon of paprika – mix until well coated
  • add the cooked sweet potato, sliced spring onions and bulgur wheat to the bowl and mix.
  • To put this all more succinctly: cook everything that needs to be cooked, prepare everything that needs to be chopped, mix in a bloody big bowl and you’re done.
  • We dressed this with a quick dressing made from natural yoghurt, minced garlic and lime juice – but actually, it stands on its own very easily.

J

Standard

Posted by

Posted on

May 19, 2015

Posted under

fakeaways, greek, indian, kebab shop, lamb, lamb mince, persian, recipe card, salad, savoury snacks, snacks, syn free, taster ideas

lamb kofta with creamy cucumbers

I’ve never felt older than I did this morning, when, standing at a bus-stop surrounded by screaming kids effing and jeffing, I tutted to myself and thought ‘kids these days’. Well actually, what I thought was ‘kids these days…if I kicked the littlest one under the wheels of a bus would I REALLY be in the wrong?’. Which is a trifle worrying but honestly, they were so loud. All the conversation was happening at twice the speed I’d expect, like someone leaning on the BPM slider on an old record-player. At one point I thought they were speaking Gujarati until I made the words ‘here-man-ye-FUCKING-DONKEY’ explode through all the vocal drawls and tics. Plus half of the little scrotes were smoking, albeit they were doing that affected ‘suck in a tiny bit and exhale like you’re trying to blow out a chip pan fire’ smoking. I mean if you’re GOING to smoke do it properly, I didn’t hear one lung-rattling cough amongst them. Amateurs. I was on half a tin of Peterson Old Dublin at their age.

You may wonder why someone as sociopathic as me was on a bus – well, I had to take my dear little car in for a service. It’s a brand new car so there should be no problems and it could have waited but see, my windscreen wipers were leaving an annoying smear on the window and rather than just clean them myself, I just took the car in for a full service and asked for a new set. We’re terrible with money, what can I say. But we’ve got no debt so we’re doing something right! I had to sit outside the dealership for twenty minutes waiting for someone to open up, and then I was immediately cut up in the queue by someone with a nicotine fringe and Build-a-Bear shoes. It’s OK, I’m British, I’ll queue politely and stare at the back of your greasy head with such unimaginable fury that I’m surprised the word KNOBJOCKEY didn’t burn across your ears.

He was booking in his bellendmobile for a service too and I almost ground my teeth into diamonds at his excruciating exchange with the receptionist. See, she asked him what time he wanted to pick up the car, he replied ‘Whatever time is good for you, I’m easy’. That made me vomit gently against the back of my teeth but I held it back. She then suggested 4pm – nope, no good, he was picking the kids up. 5pm? No, he was taking his mother to hospital. 3pm? He’d be at work. Tomorrow morning? He drives a lorry for a living, he’d be away. I mean HAWAY MAN, it’s not bloody hard to give HER a time instead of trying to be a smooth bastard with your plaitable earhair and chip-fat musk. After what felt like enough time to the rubber on my tyres to perish in the sun, he fucked off, it was my turn, I signed the car over and was away before she could click her pen.

The bus, then. Awful. For so many reasons. Firstly, I like my own personal space. I don’t like sharing that personal space with someone for whom deodorant and mouthwash are part of an “alternative lifestyle”. I immediately tune into their every defect – the way their nostrils whistle when they breathe out, the way they click their teeth over every speedbump, the way they lean against me as the bus turns a corner. I hate it. I’m not perfect by any stretch but see that’s why I contain myself in a car. People don’t respect personal space but I probably take it to the other extreme – I wince like a beaten dog if someone so much as gets in the lift with me.

Plus, the journey cost me £2.20. For a distance no greater than two miles, all downhill. Had I not been worried about my lovely shirt, I could have laid on my back and barrelled down the hill like a roll of carpet. I could even have walked (shock, I know, but even I’m not fat enough to decline a walk downhill) but I would have been late for my dentist and he’s the last guy I want to piss off. That’s extortionate, and it took almost half an hour because the bus stopped quite literally every 100 yards or so to let someone off and on, with all their bloody questions taking another five minutes. The driver had all the charisma of a roadside piss and snatched tickets and cash like he was on the Crystal Maze. I don’t doubt there are exceptions but do they make all bus drivers go to a training camp to thrash all the human decency out of them? Or is it dealing with rotten human beings all day that turn them into such miserable buggers? I saw someone stumble over the word Megarider and I honestly thought the driver was going to punch her on the tit. 

Ah well. The dentist went very well – I’m not even going to write a sarcastic recount of that, because I just can’t fault my dentist. He’s lovely. He takes the time to tell me what he’s going to do and I think he must minimise anything that ‘hurts’ because I rarely feel a thing. Apparently I have animal teeth AND naturally white. Not surprised, what with all the “whitening solution” I’ve had cascaded over them over the years, am I right? If I was richer, I’d have every last tooth torn out and replaced with big fake white teeth. I know it looks unnatural but it’s the one thing about me that I’m genuinely shy about – even though my teeth are pretty decent.  Paul hides his teeth all the time too, despite having a lovely smile – but in the nine years we’ve been together I’ve never been allowed to look at the back of his mouth. The guy is happy enough texting me a picture of his balloon knot with an ‘URGENT: OPEN THIS’ caption, but his teeth? No. Weird.

Anyway, as it happens, the car came back completely free of any worries and they replaced the blades for nowt because they should have lasted longer! RESULT.

Tonight’s recipe, then:

11329947_883520991721505_840740268862043942_n

to make lamb kofta, you’ll need:

ingredients for the kofta: 900g lean lamb mince, 1 large onion, 3cm piece of root ginger (peeled and chopped), 2 cloves of garlic, 1 chilli pepper (deseeded), 1 tsp ground cumin, 2 tsp ground coriander, 2 tsp garam masala, 1tsp salt, 1 egg

to make lamb kofta, you should:

  • throw the onion, ginger, garlic, chili pepper, cumin, coriander, garam masala, salt and egg into a food processor and pulse until it makes a grainy paste
  • mix together the minced lamb and egg, and then combine with the paste mixture
  • leave to rest in the fridge for half an hour
  • divide the mixture into ten portions and roll out into a thick sausage shape – you want it to be about the size of a penis that, when presented, you wouldn’t get very excited about, and skewer
  • in a small bowl mix together a little fat free yoghurt with a drop or two of oil and add a pinch of black pepper
  • using a pastry brush, lightly coat the koftas with the yoghurt mixture
  • grill under a medium heat for around 5 minutes per side

We served this on a HEB WW tortilla bread from Tesco, plus some tomato and a giant lettuce leaf. 

ingredients for the creamy cool cucumbers: 1 cucumber (sliced thinly), 1 onion (sliced), 60g fat free natural yoghurt, 1 tbsp white wine vinegar, 1 tsp sweetener, pinch of salt and pepper, 2 tsp dill

recipe: 

  • mix together the yoghurt, onion, white wine vinegar, sweetener, salt and pepper
  • pour over the cucumbers and toss well to mix
  • sprinkle the dill over the mix just before serving

Listen: I know I go on about this all the time. But if you haven’t got a mandolin slicer, bloody well get one. Fair enough you might circumcise the end of your fingers but it’ll be worth it – you can slice your onion and cucumber for this recipe in less time then it would take you to get a knife out of the block and crack a few jokes about the girth of the cucumber. The one we use is from Amazon and is brilliant – and only £12. Think of all the time you spend crying over your onion and irregular slices. Treat yourself. It’s this or chocolate.

Better to make this just before serving otherwise the cucumber leaks its water and the sauce looks like something you might get treatment at the clap clinic for.

End on a high!

J

Standard

Posted by

Posted on

February 15, 2015

Posted under

fakeaways, greek, mince, pasta, poultry, recipe card, syn free

greek turkey meatballs

Surreal sight #477 in Tesco today. Well, no, just outside of Tesco, some biffa standing next to her bags with an inhaler in one hand and a cigarette in the other – she’d take a couple of drags on her cigarette and then a quick puff on the inhaler. Now THAT’S commitment. Even when you can physically feel yourself choking, you carry on – oxygen is for pussies, after all. It’s like opening an AA meeting with a swift half and a celebratory chaser. Takes all sorts. Anyway, there’s a rant coming, so batten down the hatches.

I’m going to write about tweaks today. Before I start, know that this isn’t exactly the official Slimming World position, but rather my own. Obviously.

To me, the ‘no tweaks’ rule is something Slimming World have put into place to stop you blending eighteen bananas into a smoothie for breakfast, or using two tubs of Smash and some Splenda to fashion a small motor car to take you to McDonalds. The logic is over-consuming is easy – you can drink a smoothie in moments but it would take an age to eat the fruit that goes into one, and you’d likely stop before you’d even had a third. You’d need to press a whole lot of apples to make a glass of fresh juice, but one apple would normally curb your hunger.

But people take it to ridiculous levels, and my carrot cake overnight oats from a week or so ago caused a bit of a stir because I said it was syn free despite it having a mashed banana in it. If you follow the Slimming World rule about fruit to its absolute base level, then yes, it should be synned. But, if you apply logic and reason, there’s no difference to me mashing the banana using my fancy-pants potato ricer than there is mashing it between my teeth. Using a masher isn’t going to coat the banana in Nutella, it isn’t going to ‘add sugars’ or ‘release the fibre content’ any different. Sugar doesn’t float about in the air like a midge, waiting to strike the very second you cut into a piece of fruit. Some try and say that you’d use up energy chewing your banana which you don’t do if you mash it in a bowl – perhaps, but I’m not a fucking snake, I don’t dislocate my jaw and swallow the bowl and its contents without chewing, for goodness sake. I have a banana every morning on top of my porridge, the only difference here is that it’s inside my porridge as opposed to sitting on top. It’s still going to be chewed, digested and turned into a gentleman’s egg a few hours later – and I’m not going to fucking syn it!

What irks me more is that there’s always a curious sanctimony applied with the rule, with some people delighting in pointing out ‘BUT THAT SHOULD BE SYNNED’ like they’ve got Margaret MB standing behind them, pointing a pistol at the back of their shaking heads. A rule is a rule, but common sense also needs to apply. I mean, you’re not exactly supposed to stop in the middle of a road, but you do if an ambulance needs to be past – you don’t sit there blocking it, sucking air through your teeth and going WELL THE HIGHWAY CODE SAYS OTHERWISE as some poor bugger has his chest pumped in the back. I’ve been told before that it could confuse new starters, well, perhaps so – but my nephew still craps his pants because he hasn’t got the hang on his potty quite yet, should I start wearing adult nappies so he doesn’t get a complex? Haway!

And finally, what really riles me about being told off about my tweaking is that the very same people will sit there and tut and huff about a cake made from chickpeas but will then make a brownie using a bollockload of artificial sweetener until their countertops look like the inside of Kerry Katona’s fucking nostril. At least I cook proper, healthy, nutritious food instead of manky, artificially-sweetened pap – even if I do have the temerity to use a mashed up banana. FORGIVE ME.

BAH. After that, I could murder a cigarette, but I don’t smoke, and I don’t know where my old salbutamol inhaler is. Anyway, after all that, here’s tonight’s recipe which is actually bloody delicious!

10915024_835894003150871_529065894988807927_o

to make greek turkey meatballs you will need:

300g of chopped frozen spinach (defrosted), 500g of turkey mince (very low in fat), 3 cloves of garlic chopped so finely, an egg, tsp of oregano, salt, pepper, 90g of crumbled feta (45g is your HEA, but this serves four) and you might, dependent on the quality of your mince, need some breadcrumbs – if so, chuck in 25g of dried breadcrumbs (4 syns – so 1 syn each) but we didn’t need them. For the sauce, a pot of passata, garlic, onion. Spaghetti, any.

to make greek turkey meatballs you should:

nothing more to it for the meatballs than combining everything together for the balls into one bowl, mixing and squeezing and really blending it with your hands and shaping it into 24 balls. Stick them onto a non-stick tray and pop them in the oven for twenty or so minutes on 180 until nicely browned. Meanwhile, cook your spaghetti. Make a simple tomato sauce by mixing passata, sauteed onions and garlic. Combine sauce with cooked spaghetti, put meatballs on top.

extra-easy: yup. plenty of spinach and tomatoes in this to make it a go-go-go. You could jazz up the sauce by adding peppers if you were so inclined but this’ll do nicely. The balls are tasty and cheesy, and it’s not often I say that.

Cheers now,

J

Standard

Posted by

Posted on

October 2, 2014

Posted under

fakeaways, greek, lunch, pulses and grains, recipe card, savoury snacks, snacks, syn free, taster ideas, vegetarian

taboulleh salad

Firstly, let’s dispense with all the flimflam and get today’s recipe card out of the way – I’m in a rush because I’m clandestinely typing out this entry whilst sitting in one of the traps at work, and if anyone hears me waxing lyrical via my iPad I’ll get my fingers broken. Plus I’m typing quickly as I don’t want to be away from my desk for too long in case people suspect I’m voiding myself. Ah look! I’ve already fallen into the too much typing…

I decided to give this a whirl because I love couscous and needed an upgrade. Plus, everytime Paul asked me what I was making, I could turn dramatically and go ‘WHOOOOOA-OH, TABOULLEH-TABOULLEH-TABOULLEH-yadda-yaaa’ like Kate Bush pretty much did.

to make taboulleh salad, you’ll need:

taboulleh

This is absolutely bloody delicious – genuinely one of my favourite recipes that I’ve found so far. Simple enough – boil the bulger wheat for 30 mins in the stock, sieve and leave to dry out. Chop up everything else and chuck it into the bulger wheat. Add very finely chopped mint and leave it to sit so all the flavours absorb. It tastes fresh, you can add peppers and mushrooms (raw, finely diced, cooked wouldn’t be all that – it would look bad and smell of farts, like an embittered shut-in) to up your superfree intake, and as long as you use the reduced fat feta as your healthy extra B choice, you’re laughing.

This is perfect for a lunchtime meal to take into the office, as you can keep it at home in a big bowl and it’ll last two days, getting nicer the longer you leave it.

Now, as an aside, I get a lot of compliments on my lunchbox. I do! It’s shiny. See?

frozzypack2

It’s called a Frozzypack, and to be fair, I only bought it because it sounded like Prozzyfack, which in turn sounds like something you’d get behind a skip on an industrial estate in Middlesbrough. No, these lunchboxes (£20 or so) have a built in gel in the lid – you chuck the lid in the freezer and the gel sets solid, which, when you then put the lid on your salad, will keep it cool and crispy until you come to it at lunch. They come in all sorts of colours. In the interest of fairness and equality, you can buy cheap versions of these from Poundland or Wilkinsons or similar, but the Wilkinsons in Newcastle is dog-rough so I don’t bother. I’ve almost seen people coming to blows over a multipack of Bloo. Plus, it looks elegant and the hard shell design means it survives a good beating. Fnar.

Back to work. Can you believe I’m working overtime again. No wonder I’m losing weight, I’ve never got any fucking time to eat! BAH.

J