Category Archives: vegetarian

Vegetarian recipes

Standard

Posted by

Posted on

January 26, 2017

Posted under

airfryer, low syn, lunch, pork, pork joints, recipe card, savoury snacks, snacks, syn free, vegetarian

ham, pease pudding, roasties and er…rumbledethumps

Yes, rumbledethumps. It sounds like a coy euphemism for getting nasty but actually, it’s a very pleasant side dish of cabbage and potatoes. If anything, having cabbage tends to exclude any possibility of having nookie-noo later thanks to all the resulting flatus. But give it a go!

Just a very quick recipe tonight thanks to Paul and his big fat arse. No, let me finish. See, for about four months now, our computer chair has been slowly breaking under our combined weight/bouncing/spinning/wanking. One of the arms snapped off a few weeks ago but that’s alright, as long as you hold yourself stiff (and god knows I’ve got plenty of experience keeping myself stiff in front of the Internet) you can still type. But about a fortnight ago the hydraulics started failing and we would end up sinking, ever so slowly, closer to the floor as we typed. That’s fine until you realise you’re typing with your eye-line just over the top of the keyboard and your neck sounds like a cement mixer.

Things came to a head last night when Paul leaned back in the chair to contemplate my offerings of Chinese or Indian when there was a tremendous crack and the entire back of the chair came away, sending him hilariously to the floor, rolling on his back like a stuck turtle. Paul falling over anything always cracks me up and I spent a good five minutes clutching the settee and laughing until my vision went blurry and I had to sit down. I think it’s because he makes a proper comedy fat-person noise when he tumbles – the sort of noise a bouncy castle would make if you drove a car into it. I’m a terrible husband, aren’t I?

So yes, picture me now, sat here, legs bowed under me, no back support, the gentle hiss of air escaping as I’m lowered further and further to the floor, and you’ll understand why I must hasten to the recipe! On we go…

rumbledethumps

To be honest, this meal is just a collection of nice things so although I’ll cover the other three bits, rumbledethumps is what I’ll focus on. It’s a lovely side of potato, cabbage, onion and cheese, and let’s be honest, everything is better when covered in cheese. Nearly everything. No-one like a brie lollipop, just sayin’

ham

Nothing more fancy than Waitrose’s Pulled Ham Hock (I think Paul did that yesterday when he fell out of his chair) pressed into a nice shape with a ring-press (think he did that too) (you can buy a mould here) and topped with a tablespoon of piccalilli. The ham is syn free and piccalilli is half a syn per tablesspoon but I never syn it because I’m a frightful slut.

pease pudding

We buy our pease pudding from a lovely local business called Pete’s Puddin’ – it comes in bog standard flavour, Newcastle Brown Ale flavour, Cheese and Pickle flavour and best of all for someone like me who would happily main-line the stuff straight into my veins, Marmite flavour. I bought the stuff because I was so taken with his puns (and also they were selling it in Sausology, another local business) and never looked back. It’s amazing – you can find buy it yourself here: http://www.petespuddin.com/ 

I know pease pudding isn’t for everyone but we bloody love it and the flavoured versions are almost guaranteed to give you the proper fanny gallops if you try them. I’m not recommending this product because we’re getting a kickback or money or half an hour with a rough-handed lorry driver in a pool of pease pudding, no, I’m recommending because it’s bloody delicious. Plus, it’s good to support a local industry, and you cannot get any more local than buying pease pudding from the market in the centre of Newcastle. Well, unless Denise Welch was stottin’ a stottie offa Cheryl Cuuurl’s heed next to you, haway man pet etc. No, you haven’t tuned into Vera.

Oh, and it’s syn free.

roasties

We often have these tiny roasties – if you’ve got an Actifry, and if not, why not, just cut your potatoes up nice and small, whack on some worcestershire sauce and two oxo cubes and set them away. If you don’t have an actifry, cut the potatoes up, make a thickish liquid with two oxo cubes and a splash of water, tumble the potatoes around in it and cook in the oven until scrummy-yummy. Scrummy-yummy? Yes, I vomited into my mouth on typing it too.

rumbledethumps

Best to use leftovers for this but let’s just say, for the sake of argument, you can’t be arsed and/or you’re too fat to leave leftovers. That’s us. This makes enough for four people as a side, so you know what, I’m going to use butter again! I’m using a few odds leftover from the rosti so hopefully you’ll have everything in. So you will need:

  • 750g of potato, peel them if you’re fancy – or use a mixture of potato and cubed turnip, chop into cubes
  • 500g of cabbage, any old cabbage will do, but we used savoy, sliced super thinly
  • 25g of reduced fat butter (7 syns)
  • two fat onions, sitting in a tree, K-I-S-S-I-N-G, sliced thinly
  • 120g of strong mature cheddar (4 x HEA)
  • a good handful of chopped chives
  • lots of black pepper and salt

If you’re wanting to make this quick, use a mandolin slicer to cut the onions and cabbage – it’ll be done in less than a minute. The one we use is here! Only a tenner, too!

To make rumbledethumps you should:

  • boil your potato or tatty and turnip mix for about twenty minutes until soft and then mash – don’t mash it too finely, just give it a quick going over – a knee-trembler, if you will
  • meanwhile, melt that delicious butter and gently cook the onions and cabbage, oh so slowly now, until everything is soft and cooked – takes about the same amount of time as the potatoes and don’t be shy of adding a drop of water if things start to stick
  • tip the butter, cabbage and onion into the mash mixture and stir like a bugger, adding two thirds of the cheese and a good few twists of salt and pepper
  • drop the lot into a wee oven dish and top with the rest of the cheese and some chives
  • cook for about fifteen minutes or so and then plop it onto your plates with everything else!

Eeee, what a handy way to use up spare veg. Cabbage and turnip are always in the bargain bins at tesco so help yourself!

Looking for more veg ideas? Meat ideas? Anything at all? Click the buttons!

vegetariansmallpoultrysmallporksmallfakeawayssmall pastasmall

Enjoy!

J

Standard

Posted by

Posted on

January 23, 2017

Posted under

low syn, lunch, recipe card, savoury snacks, snacks, taster ideas, vegetarian

swiss potato and gooey cheese rosti

This swiss potato and gooey cheese rosti is the mutts-bloody-nuts, I don’t mind telling you. Someone might need to slide you along the kitchen floor like a snail after your dinner – it’s that tasty. Easy to make. But, like the big pricktease that I am, I’m going to make you wait for a moment whilst I waffle on about my usual flim-flam.

See, I was going to talk about the whole pushchair v wheelchair legal case last week when it was y’know, relevant. Have you heard of it? Let me summarise. A chap took FirstGroup to the Supreme Court on the grounds of discrimination after he was unable to board a bus due to the disabled space being occupied by a pushchair. Frankly, I’d like to take bus companies to court based on the fact that I’ve never alighted from a bus without the smell of foist, BO and stale fags soaked into every fibre of my clothing, but that’s by the by. The ruling means that drivers have to do more to help accommodate disabled folk. Good.

Why am I mentioning it? Because I’m astounded that it even had to go to court. Surely good, common decency tells you that you move your pushchair and baby out of the way so that someone who has fuck-all choice as to where they sit can actually travel? Is that not blindingly bloody obvious? And yet when I read online discussion forums about the story they were awash with people saying ‘you can’t wake a sleeping baby’ and ‘it’s not fair expecting a parent to move, they might be tired’! What the hell is all that about, is the baby made from aged nitroglycerine? I know that every baby is special to their parents but the Earth span before the baby and it’ll sure as hell continue afterwards. Perhaps if the pushchair wasn’t the size and build of a Russian Army tank you’d have less of an issue. Buy a smaller pushchair. Put the baby in a sling. Carry it in a papoose. Stuff him safely overhead in the overhead locker bins but be careful as contents may have shifted during transit. If you choose to wheel around a pushchair bigger than Paul’s smart car then be prepared to fold it away if you need to.

Before I get people complaining, just to be clear, if the child has difficulties or it’s a special needs wheelchair then of-bloody-course they should stay on.

There were cries of ‘if disabled people want to be treated equally, why should we make exceptions for them’, which makes me steam at the ears. We’re not talking about laying on a special bus full of blowjobs and cocaine, we’re talking about letting someone ride public transport exactly like everyone else. That’s not an ‘exception’, that’s bloody right! I’d hazard a strong guess that the absolute majority of wheelchair users use their wheelchairs because they have to, not because they fancied being eye-level with everyone’s arses for the day. It’s not like it’s a fairground ride, for goodness sake.

You see it with mother and baby parking spaces too. I can see the merit in them – I absolutely can – but I’ve seen several times over people trying to justify parking in disabled spots because the mother and baby spots were full. Why? If your child is disabled, absolutely fair enough, but if not, park in a normal bay away from other cars and crack on. People managed to get out of cars before without much difficulty. My mother used to haul me and my sister out of our battered old Ford Escort with one hand, the other hand being preoccupied with lighting a Lambert and Butler or smacking our arses for fighting / shouting / breathing noisily. Didn’t do me any harm, and she managed to do it without leaving the car next to her looking like it had been used for a drag race. My arse cheeks did, but that’s beside the point.

I understand the point about ‘not wanting to walk with children across a car park’ but haway, it’s a two minute trundle across Tesco car park – you’re not walking the Hindu Kush. Keep your children smartly to your side and you’ll find it a breeze.

Ah, what do I know, I don’t have children. If I did they’d be raised like Jane and Michael Banks from Mary Poppins and they’d say spit-spot all the time and smoke pipes. And, let me tell you this – if I had them in a pushchair and someone in a wheelchair came aboard the bus, I’d cheerfully strap my children in their pram to the back of the bus and let them ride like the Beverley Hillbillies. It’s just time people stopped being so precious.

Bah. Right, if you feel the need to send me angry words, don’t worry, you needn’t rush to do so.

Oh and as an aside, hasn’t The Archers been delicious recently? Hearing Rob fall apart has been wonderful! Let’s get to the recipe though, eh? I was inspired to make this from something gorgeous that I put in my mouth in Switzerland. He was a potato farmer called Luca and he smelled of Gruyere. Boom boom. This makes one giant rosti which will serve four – I put a quarter on a plate with some sausages and sauerkraut. You know what the best part about this rosti is? It uses butter! Proper butter. Yeah, it adds syns, but not much at all! Plus it’s so easy. Even you could do it! You will need to plan ahead though because step one of this recipe involves doing something the night before!

swiss potato and gooey cheese rosti

to make a swiss potato and gooey cheese rosti you will need:

  • 900g of good floury potatoes, like Maris Piper
  • salt and pepper
  • 25g of reduced fat butter (7 syns)
  • 120g of Gruyere cheese (or cheddar or whatever you like) (4 x HEA) (this serves four, see)
  • a bunch of chives, chopped finely
  • two teaspoons of olive oil (4 syns)

You’ll also need a good pan, about nine inches. If you find nine inches a bit of a struggle, you can use a slightly smaller pan, and just tell people it’s nine inches. It will need to be ovenproof, mind.

to make a swiss potato and gooey cheese rosti you should:

  • this is the key bit – boil your unpeeled whole potatoes for ten minutes in boiling water and then leave to cool overnight until they’re absolutely cold and dry
  • coarsely grate your potatoes – peel them first if you like, but I didn’t bother – I just grated them with the peel on. Now, grating potato is a ballache but we used our Magimix and were done in less than a minute – and look, it’s so pretty!
  • mix the grated potato with a good few crunches of salt and pepper – I really went overboard with the pepper as I don’t think you can have too much, and add the chopped chives for good measure
  • heat your pan on a medium heat with one teaspoon of oil – I use a little wee pastry brush to make sure the whole pan is coated in the oil
  • add half the potatoes and press them down with a spatula, making sure it’s pressed down tight and right to the edges
  • take half of the butter and cut it into tiny slivers, poking these slivers down the sides of the rosti around the pan – leave the rosti to cook for about 5 minutes or so until nice and golden underneath
  • spread the cheese over the top of the rosti, keeping about an inch away from the edges, then cover with the rest of the potato – think of it like making a cheese sandwich – press everything down
  • now the tricky part – how to turn the rosti. You might want to get someone to help you if you’re a clumsy fucker like me but it’s actually not too hard
  • get a flat plate and place it over the top of the frying pan and then quickly flip the pan and plate over, so you’re left with the rosti now the cooked-side up on the plate
  • add the rest of the oil into the pan and gently, oh god so gently, slide the rosti back into the heated pan
  • repeat the butter trick with the rest of the butter and cook for five minutes or so until golden whilst you preheat the oven to 190 degrees
  • transfer the pan into the oven and cook for about fifteen minutes just to finish off the colour then, once it has cooked, take it out and cut into quarters
  • serve with whatever you like – buttery, cheesy rosti goodness awaits!

Now see, I know I’ll get people not trying this because it uses syns, but it’s not many and it’s bloody worth it. You could use frylight, but then you could just eat the foam out of your cushions too. Get it made!

Looking for more inspiration? Click the buttons and get buttering your muffin!

poultrysmallbeefsmallporksmalllambsmallfakeawayssmall lunchsmallpastasmall

J

Standard

Posted by

Posted on

January 21, 2017

Posted under

chinese, fakeaways, low syn, lunch, recipe card, salad, savoury snacks, snacks, taster ideas, vegan, vegetarian

carrot, mint and ginger salad – a quick and easy Slimming World lunch

Here for the carrot, mint and ginger salad? Can’t wait to get chomping? Well, haud yer wheesht, because as ever, we have some flimflam.

You know what I hate? Facebook’s Timehop service. Those whose internet experience amounts of replying positively to Nigerian Kings and typing ‘dancing jesus website lolz’ into google may be unfamiliar with it, so let me explain, as it’s very simple. Every other day Facebook will find a photo of you from many years ago and show you it in the vain hope you’ll go AAAH HOW LOVELY and post it. Not me. No, all I see is my youthful looks staring back at me accusatorially, demanding to know what Present James has done with his life to warrant wrecking Past James so horrifically. Occasionally the brightness of the iPad is bright enough that I can see my own current face reflected back on my young previous face and I feel like Dorian looking ashen-faced into his portrait in the attic. I know we all change (“We all change, when you think about it, we’re all different people; all through our lives, and that’s okay, that’s good, you’ve gotta keep moving, so long as you remember all the people that you used to be“) we all age, but I swear I’m not ageing so much as I am melting into a hairy, gelatinous landslide of fat. It’s like the slowest Doctor Who regeneration ever – only I’m turning from James van der Beek into Chewbacca’s stunt double. Paul would be Billie Piper, he has the three-cock-gob. So yeah, Timehop can fuck right off.

I did something yesterday which I haven’t had to do for a long time – no, it wasn’t fumbling my way around a vagina and nor was it paying my driving test examiner to pass me despite the blood congealing on my frontbumper – no, I had to learn something. See, I’ve plodded on in my job for many years (and thoroughly enjoy it, mind you) (that one’s for HR) but recently they’ve very kindly agreed that I can broaden my responsibilities and have sent me for training. This means lots of revision and travelling and attending training. Fine for most people, but I struggle to concentrate – I get distracted and tired mid-piss, for goodness sake.

Nevertheless, I gamely headed to London yesterday, making sure I get in as many people’s way as possible as I farted about trying to find my way to Canary Wharf. Unusually for me, I managed to get there without much difficulty or upset, and I took my chair as the lecture began. I’d bought myself a nice new notebook and Paul’s Christmas present to me, a fancy fountain pen. I can’t write in Biro because we were forced to use ‘proper pens’ at school – you can imagine how difficult that was for me as a left-handed eejit. Every essay I wrote was a collection of smudges, stains and wrist-stamps. I had that much black ink on the side of my hand that my doctor thought I had frostbite. I’ve mastered the art now and as long as I take my time and don’t over-excite myself, I can write coherently.

The one thing I didn’t have was a wee desk. This made the whole thing quite difficult – try writing notes whilst you’re balancing a slides handout, A4 notebook and colour examples on your knee, especially when you have to write all cack-handed anyway due to being all sinistra (did you know that was the latin root of sinister, so, left-handed people are evil? Makes sense, I had no compunction about breaking wind on the escalators on the Tube yesterday). On top of that I have the anxiety of not wanting to write too much but also not missing anything, and every time I set my pen down, the lady next to me immediately started writing. It was like that duelling banjos scene from Deliverance, only with a far less troubling outcome. In the end I managed to pay attention and have six beautiful pages of notes to coo over. After the lectures, the worst part of all: networking.

I can’t network to save my life. I know it’s an acquired skill but, despite the three years of this blog, I hate talking about myself and have a bit of an inferiority complex when it comes to talking about what I do. I had it in my mind that I’d make up a bewildering, breath-taking back-story, but instead I spluttered my tea and stumbled my words. I must have looked like a simpleton. It didn’t help that whilst I was talking to the vert first victim I’d picked to talk to, I dunked my cookie into my tea only for it to fall in, meanly I had to gamely drink my tea with floating crumbs bobbing around on top whilst they chatted about what they do. Next time I’ll just pick up a cookie and go hide in the toilets like everyone else.

Ah well. I might as well be remembered as the cookie guy as opposed to the heavy-breathing-notes-taking man, I suppose. Networking finished, I realised that I had three bloody hours to kill at Kings Cross before my train, thanks to my penny-pinching ways of buying a non-transferrable ticket. I couldn’t even get into the First Class lounge as you’re only allowed in there two hours before your journey. It was rush hour, there wasn’t a single place to sit anywhere in the station, my bag was too heavy to go anywhere exciting, so I just sat outside and people watched.

I know it’s an unoriginal thought, but Christ, London is so busy. Where do all these people, scurrying about like ants on a sugar pile, live? Where do they work? I like to imagine all the threads of their lives crossing over this way and that, all in one giant tangle, and then my head starts hurting so I move my thoughts back to thinking about chips. I spent 30p to have a pee, which I still think is outrageous even now – if I have to pay to piss, then surely I should have the option of saving my money and being allowed just to piss on the tracks instead? Bastards.

After an hour or so I attempted to make my way to the First Class lounge only to be caught up in a giant mass of people all thundering for a train whose platform had just been announced. You know in old cartoons when they’d start fighting and disappear into a comedy smoke bubble with flailing limbs popping out? It was like that, only with a lot more cheap aftershave and hooraying. I was deposited out five minutes later all dazed and confused and, after a brief interlude where I was pushed around Little Waitrose by a heaving queue of focaccia buyers, stumbled into the First Class lounge.

I wish I could say there was respite to be had but no. It was busy, as you’d expect, but that meant it was full of the type of businessmen who need you to know how important they are by bellowing loudly into their phones. On top of this, I kept getting icy stares and extremely loud sighs and harrumphs from an older lady who seemed to take great offence to the fact I’d sat next to her in the only spare seat in the lounge. I didn’t let her know that I took great offence to the fact she’d seemingly put her make-up on four times over, so why was she giving me such cold looks? She soon stopped when I stared right back. I was tempted to do that thing of putting two fingers on my lips and flapping my tongue through but I didn’t want to be bundled out before I’d managed to secrete as many free bags of crisps as I could into my bag. As it happens, I decided to leave soon after I came in as it was all so very stuffy. I people watched for a while longer, made my way through the 5kg of Corkers crisps I had in my bag, and then got the train. Aside from having someone who was clearly unwell jibbering away across the aisle and the train being delayed thanks to ‘problems with the tension’ (I presumed it was sexual tension from seeing me dashing aboard in my Jacamo coat and sensible shoes), it was an entirely uneventful ride home. Job done. Until the next time…

Final thought – Paul has been raving at me about an online internet station that plays all the old nineties music we like without any crappy DJ linking the songs together. I mean, seriously, he hasn’t shut up about it, but I kept dismissing his bold claims because his Spotify playlist consists of Tracy Chapman, more Tracy Chapman and Now That’s What I Call Amyl Nitrates. However, he left the SONOS player open and I stuck on the previously played tracks – and they’re all brilliant. I mean, haway, the song that is playing right now is Ain’t No Doubt by Jimmy Nail, a man who is nothing more than a steel-capped workboot given a tongue and lips. The station is Pride Radio 90s. Yes, the rainbow face made my eyes bleed too, but we can overlook the trivialities, can’t we.

Proper final thought – can you lot calm the fuck down over these Fiber One bars? Jesus Christ man. I’ve seen so many fights and arguments with grown women calling each other worse than child-murderers for having the temerity to buy a few boxes of these in the supermarket. Why? They taste shite, they’re tiny, they’re full of chemicals and you’d get more flavour sucking on the doormat. I swear it’s very much a Slimming World thing – something gets ‘recommended’ on facebook by a couple of people and then hundreds of adults start storming the supermarkets like the boxes came with half an hour of cunnilingus by Tom Hardy. I’ve seen photos where people have bought 30 or 40 boxes and I just think, Christ, have some bloody dignity. It’s not about ‘saving some for other people’, you have as much right to buy them as anyone else, but you’re only buying them because you’ve seen others doing the same. Don’t be a bloody sheep, especially not one who is brawling in ASDA and calling others ‘fukin greedee slags’ all for the sake of a shit bloody brownie.

BAH!

Right, with all that out of the way, let’s get this recipe done, eh? You might be thinking that a carrot salad is boring, but if you’re a fan of carrots, I can guarantee it’s worth a go. I made this for a lunch but you could easily use it as a side on one of our dishes that don’t have the third speed in it. You could add cooked noodles into this to bulk it out, if you wished. You know how Slimming World have launched those little salads in Iceland that you can have for your lunch? Think of this like those, only fresher as you’re making them yourself. Yes, it has a couple of syns, but absolutely worth it. We used two packs of Marks and Spencers rainbow carrots (£3 for two packs) but you can use bog standard carrots if you want. We won’t tell. This makes enough for three hearty portions.

carrot, mint and ginger salad

to make carrot, mint and ginger salad, you’ll need:

  • around 400g of carrots, baby ones are better, peeled
  • two shallots
  • fresh mint (or dried, but fresh always better)
  • a little knob of ginger (about half an inch), peeled and grated
  • tablespoon of mustard seeds
  • juice of half a lime
  • tablespoon of olive oil (6 syns) (you could use lemon flavoured oil here, be lovely)
  • good pinch of salt and black pepper

to make carrot, mint and ginger salad, you should:

  • chop your carrots into strips or, even better and far quicker, julienne them using one of these – much easier and you’ll get nice uniform strips
  • thinly slice the shallots
  • it’s much nicer if you toast off your mustard seeds – chuck them in a dry pan on a medium heat for a minute or two, just until you get the scent of them, and then take off the heat
  • grate your ginger nice and fine (yep, I know, predictable, but please, buy a mincer for your ginger, then just freeze a big lump of ginger and grate it as and when you need it straight from frozen!
  • mix everything together in a bowl and top with fresh mint and give everything a good tumble with your fingers

This can go a bit watery if left after a while, that’s fine – just dress it when you want to eat it. You could add sliced peppers and noodles, remember. This would work very well as an accompaniment to curries!

Right, that’s all done. If you want more veggie dishes, lunch ideas or other such nonsense, click the buttons below! You know you want to.

fakeawayssmall lunchsmallpastasmallvegetariansmall sausagessmall  Enjoy!

J

Standard

Posted by

Posted on

January 18, 2017

Posted under

desserts, low syn, overnight oats, recipe card, snacks, sweet snacks, taster ideas, vegetarian

cranachan – a perfect Slimming World dessert that totally isn’t overnight oats

Cranachan? Yes, that’s right, it sounds like something you’d rub on an irritated cha-cha but it’s not! It’s lovely. But first: nonsense.

In what I’m sure is karma for eating naughty synned things, I’ve just knocked an entire Sherbet Fountain across my glass desk, into my keyboard, into my mouse, onto my monitor – great! Everything is going to be sticky and covered in white streaks for months now – or well, until the cleaner comes. She’s going to think I’ve got one hell of a coke problem although Christ, she ought to know better – she’s ironed enough of my X²L shirts to know my body isn’t being ravaged by drugs. I expect the cat will be along later to sample the spillage and I’ll find her off her tits rolling around showing her minnie off to the neighbours. What fun we have.

Anyway, that’s a completely unrelated opening to what I’m going to talk about today, which is Scotland. Why? Because tonight’s dish is a bastardisation of a Scottish dessert which no doubt I’ll have some incoherent feisty Scot bellowing at me about and, more simply, I bloody love Scotland. If Paul and I could live anywhere in the world we’ve both agreed it would be Glasgow – Edinburgh is lovely, but I like a shade more menace when I’m ordering a crème de menthe in a social club. The accent is amazing – and that’s coming from a Geordie – everything sounds slightly angry and inquisitive but every single insult is hilarious. Even as simple as calling something mince – we have shite, but mince is perfect.

The landscape is beautiful – I love the fact you can trot anywhere in any direction and within an hour be somewhere completely different, not only in location but also feel, sound and sight. I’ve never had a disappointing trip up North and when we drive past the sign welcoming us to Scotland I’m always cheered, not least because I’m usually busting for a piss at this point and I know there’s a shitter in Jedburgh. Most of our holidays were in Scotland as a child, wild camping around the coast and enjoying many a summer having the first two layers of my skin chewed off by midges. Don’t get me wrong, we’ve got midges down here and they’re a mild annoyance, but in Scotland they’re armed with knives. I remember my parents optimistically scanning their camping guidebook and selecting what sounded like a charming place somewhere near Glencoe. When we turned up, announced in advance as always by the spluttering engine of our car and the blue smoke pouring from both the exhaust and my parents nostrils, the place was an absolute dump. Literally, a dump: there were abandoned cars, old fridges, massive mud piles, the works. It was exactly the place where you just knew the car of the family who had arrived before you would be ablaze in a woods nearby with their skins hanging up in the owner’s living room. You could have crashed a plane into this campsite and improved it. Naturally, my dad dickered about the price for a bit and was all ready to set the tent up when my mum put her foot down and demanded we leave.

You know the worst thing? I’m fairly sure the place was called Red Squirrel and when I look at it now online, it looks bloody idyllic. Harumph. But anyway, enough reminiscing, I promised Paul this would be a super-quick post as he wants me to ped-egg his feet. We bought one of those fancy motorised versions so I’m fully expected to be diagnosed with popcorn lung from inhaling the microdust of his shaved feet for an hour.

Oh: as a final thought – we’ve never met a Scottish gay who hasn’t been hung like God was trying to give him a third leg and ran out of time before he put the foot on. I’m just saying. Is it something in the water? Goodness me!

So yes: cranachan. This Scottish dessert is usually made with double cream whipped thick, but alas, I reckon if I put that into a recipe it’ll be the very thing that tipped poor Mags back onto three bottles of Taboo a day. So – forgive me Scotland, I know not what I do – I’ve replaced it with Greek yoghurt. The rest of the ingredients remain though – whisky, honey, oats and raspberries. It’s like a fancy overnight oats recipe – one you might whirl out if you were trying to persuade your husband to give you a bit of the other. You could leave the whisky out, but it really is a key part of this, and it doesn’t overpower the dish so it’s absolutely worth doing. Up to you how you want to portion this out – up the oats, reduce the greek yoghurt, add more raspberries, or throw it all in the bin and have yet another Vienetta. I don’t mind! I saw cranachan on Come Dine With Me a while back and made a note to find a recipe – it’s thank to Caroline at Caroline’s Cooking for the inspiration. Let’s do this then – this makes enough for one big glass as shown below – scale up or down if you are making more or eating your dinner from a dustbin lid.

cranachan

to make cranachan, you’ll need:

  • 40g of oats – the better quality the better, like Quaker, but you can just use normal porridge oats if you like
  • a big handful of fresh raspberries
  • 100ml of thick Greek yoghurt – but make sure it is 0% fat and syn free (or as low as possible)
  • a teaspoon of honey (1 syn)
  • 25ml of whisky (3 syns)

We’re not massive whisky drinkers here at Cubs Towers so we just bought a tiny bottle of Haig Club, which I now know is David Beckham’s brand. I mean, how embarrassing. Now, there’s no easy way for me to link to Amazon in tonight’s post, so why don’t you just buy my new book instead? I promise it’ll make you laugh at least once. Promise.

to make cranachan, you should:

  • toast off your oats in a pan – they don’t brown, but you want them heated through so they smell nutty
  • crush your raspberries lightly with a fork – don’t mash them, whatever you do, god no – so that the juice runs a little
  • combine your yoghurt, oats, honey, whisky, raspberries and honey in a glass and stir, or if you prefer, layer it all in all fancy like
  • serve with a couple of raspberries on the top and some of the oats
  • lovely!

This was a lovely, filling, unusual dessert that is easily customisable to your tastes. It’s overnight oats but a bit more grown up and we loved it!

Looking for more dessert, drinks or snacks ideas? Click the buttons!

dessertsmallslowcookersmallovernight-oatstastersmallsoupsmallnaughtyfooddrinkssmallbbqsmallonepot

J

Standard

Posted by

Posted on

January 15, 2017

Posted under

breakfast, low syn, lunch, quark, recipe card, savoury snacks, snacks, speciality ingredients, sweet snacks, taster ideas, vegetarian

low syn goats cheese and honeyed blackberries on toast

Goats cheese and honeyed blackberries on toast? Yes, I know. Fancy! But look, I’m sick of looking at overnight oats and oats recipes and overnight baked wonder-oats and bloody Fibre One bars.

Remember when Paul managed to cause us much embarrassment when he accidentally posted a pulsing sphincter onto our facebook page which resulted in us getting banned from facebook for a week? Well, that was mortifying, but he’s managed to shame us yet again. See, I was driving us to the supermarket when I stopped to let a dad and his young boy cross the road in front of us. The lad was clearly learning to ride a bike and he had an adorable Union Jack helmet on and I was feeling generous, plus I wanted a chance to put the windows down because Paul’s car reeks of those bloody awful Yankee Candle air-fresheners – he has about eight dangling from his wing mirror, which given he drives a Smart car, reduces the interior by 45%.

Anyway, Paul hadn’t noticed why I’d stopped until I explained that I was stopping to let ‘that little boy with his lovely little helmet’ cross the road. Paul’s reaction? Why, it was to shout ‘UUUUUURGH YOU DOOOORTY PEEEEE-DO‘ to me at the top of his voice for a ‘joke’. The dad looked furiously at me but hey, it’s not as though we were driving an easily-identified, tangerine-coloured car in a town full of beige Range Rovers. The kid hadn’t heard, just to be clear, he was cycling away merrily into oncoming traffic (I’m kidding, he was on the path). I fully expect to have my windows put through later this evening and have Dark Justice ambushing me as I leave work. Good work Paul, what a love!

Can I ask a question which I may have touched on before – is there anyone else out there who loves nothing more than a lazy Sunday? I always feel like we should be out doing something but see, once we’ve dragged ourselves out of bed at 11am and had our 2pm nap, there’s really not enough time to go out. I know I’m super lazy but meh, I’m happy. When you watch the TV and see all those adverts with zippy young people flying about and being exciting it makes me feel momentarily bad, but I find that feeling goes away if I just shut my eyes or concentrate on opening the Ben & Jerry’s. I did manage to resubmit my application to go on The Chase though which I’ve been meaning to do for a couple of months – I don’t know why, I’ll be uniformly terrible because I can’t cope with pressure – put me up against the clock and someone could ask me what my name was and I’d still blurt out pass and then fall over. Ah well.

Been doing a lot of boring admin on the blog today – updating the recipe list, removing some Christmas stuff and upgrading our servers behind the scenes – you should notice it is loading nice and quickly. Phew, right? We were mulling over adding more adverts but have decided to leave it for another year. To me, there’s nothing worse than loading a food blog only to have 47 adverts load up, then a read more button, then a subscribe button, then a load of tracking adverts running in the background. You’re here for recipes and hopefully a laugh, not to have us fingering through your pockets clamouring for every spare penny. Do let us know if we haven’t got the balance right, though – we’re here for you!

We’ve added a new category into our recipe page for lunches, too.

lunchsmall

See? Most of our meals can be made in bulk and taken to work the next day, but hopefully this list will identify the stuff you can easily make the night before and portion up. Hope this helps! If we make a recipe going forward that is easily portable, you’ll see this button.

Oh! Another new thing, before we get to the recipe. We thought, for nothing more than shits and giggles, to do a short video review of the new Mullerlight blackurrant and liquorice yoghurt. Give it a whirl, at least you’ll get to hear what one of us sounds like.

I know, it’s like Brendan from Coach Trip had an illicit pump-and-dump with Denise Welch and I was the resulting lovechild. Ah well.

Anyway, let’s get to the recipe, but first…

warning

It’s not even science, to be fair, but the old tweak warning banner didn’t go with the rest of the site! Here’s the thing. This recipe, which makes enough for one (but you know, scale up if there’s more than one of you), uses 100g of blackberries, but, gasp, I heat them up first in a pan. Following Slimming World’s rules to their strictest form, you ought to syn these blackberries at 1 syn. In my eyes, there’s absolutely bot-all difference between 100g of uncoooked blackberries and 100g of cooked blackberries, but I’m not here to question Slimming World’s logic – it’s up to you to make a choice here. I’ll probably get a load of people trying to explain ‘why’ this should be synned – some blah about if you chew it with your mouth you use up more energy but haway, we’re talking about blackberries here, not bloody allen keys – it’s not like you’ve got to writhe on with your mouth to burst it through. Plus, you know, we’re not making jam here.

So yes: depending on how you view the hot-button topic of tweaking (and you can read more about our views here), the blackberries ought to be synned at zero or one.

goat cheese and honeyed blackberries on toast

to make goats cheese and honeyed blackberries on toast, you’ll need:

  • your healthy extra B of bread – I don’t mind what you use – use three slices if you wish or trip the light fantastic and have a bagel or something, just syn it
  • 100g of blackberries
  • 40g of soft goat cheese (a HEA – now, if you prefer, you can use maybe 10g of goats cheese and save the rest of your HEA for something else, but that’s too complicated for us)
  • quark (now I know, it tastes of fuck-all and then nothing, but we are using it with the goats cheese to bulk it out – you may not need this if you want a full on goat cheese experience
  • 1 tsp of honey (1 syn)
  • a drop or two of vanilla extract
  • chopped mint

to make goats cheese and honeyed blackberries on toast, you should:

  • toast your bread, whether under the grill, in a toaster or placed behind a farting arse – whatever gets the job done. Is this a good chance to show off our fabulous toaster? I’m going to. No shame. It’s so pretty. I mean, look at it! Plus, just like Paul, it has an extra wide slot – though, unlike Paul, you can change how brown your slice is when you pull it out – boom boom
  • I am so sorry for the above, I ought to be ashamed
  • to make the blackberries all lovely, put them in a small pan on medium heat with about two tablespoons of water, the teaspoon of honey and the vanilla – cook for about five minutes, keeping an eye to make sure they don’t catch, and crushing them ever so delicately with a fork to let the juice out – you want the berries warmed through and nice and soft, with a little bit of berry liquor left over
  • liquor? Why officer, I barely knew her!
  • mix the goats cheese with however much quark you want – none at all if you prefer a nice strong taste – then spread on your toast
  • top with the warm blackberries and mint and enjoy!

See, how simple was that? To get all wank for a moment, it is a lovely breakfast because there’s so many flavours and textures going on. Absolutely worth a try. You could make it syn free by using sweetener instead of honey but for goodness sake, why do that to yourself? Enjoy flavour rather than a sight of a zero on your syns count, that’s what I say!

Not a fan of goat’s cheese? Use ricotta. You can have 90g of it as a HEA, you know.

Want more breakfast ideas? This one not buttering your muffin? Click the buttons and live like a Queen!

breakfastsmallsnackssmall dessertsmallovernight-oatstastersmall

Hope you all had a lovely weekend, gallivanting and adventuring around like you’re in an 1980s tampon advert!

J

Standard

Posted by

Posted on

January 10, 2017

Posted under

breakfast, desserts, recipe card, snacks, sweet snacks, syn free, taster ideas, travel, vegan, vegetarian

taster night fruit skewers

Taster night – yes, we hate them too. We do have loads of taster night ideas though right here, but here’s a new one – taster night fruit skewers! Doesn’t really need a recipe but even so, I’ve done one at the bottom. But first…

…here’s a minty-fresh Switzerland entry! Part five if you don’t mind.

swissfive

part one | part two | part three | part four

Now, the last time you nestled into my busom and let me tell you a Swiss story we were just disembarking from the train in Bern. I was giddy with superlatives and the clean mountain air. We enjoyed an evening out and explored the town and I’ll touch on that later but first, despite having just arrived, we were already planning to leave. GASP. If that doesn’t get you sticking to your chair, what will?

So, yes, the night before, somewhat shitfaced on gin and schnapps, we had rashly decided to hire a car and go see some nearby Swiss features. A company called Sixt took our money and booking only to then call us at 11pm to say that actually they couldn’t hire us a car after all. My reply was probably something like wellfuguthendon’twanyercaranywaaay, as I remind you I was drunk, and we managed to sort something out with Enterprise. Hence, a few hours later, after a quick tram ride into the ghettos (as if Swiss cities have bloody ghettos – even the graffiti says ‘FUCK THE COPS, PLEASE’) we were outside the Enterprise offices waiting for the effortlessly efficient Celine to finish putting her hair in plaits and open the door. We made the class awkward small-talk and were shown to our car – a very boring Peugeot 208. I almost asked if they had anything more exciting but realised that would encompass every single mode of transport ever invented. It’s not that it was a bad car, no, it was just…so…plain. It was the motoring equivalent of having a disinterested vicar read you the warranty conditions of your new kettle.

We set off, very gingerly. Actually, that’s a fib, it took us about ten minutes to figure out how to disengage the handbrake. Every button I pressed seem to do something I didn’t want (and I’d later discover I’d accidentally set the seat-warmers to maximum – I only realised when I pulled over absolutely sure I’d shit myself). Paul fiddled with the Sat-Nav. You may recollect from previous entries that I have an inherent distrust of Sat-Navs whereas Paul clings to every word like a drowning man would clutch a lifebelt. The Sat-Nav is never wrong. It could instruct him to plunge a knife into my chest then take the third exit and he’d have the cutlery drawer open before you could say Skynet.

I’d checked online previously and the motorway that we needed was a mere half mile and two junctions away – I thought that once I was on that we’d be grand – driving on a motorway is an easy way to get used to a car, unless you’re Henri Paul. Paul plugged the address for the cheese factory in and we were away, guided by the disembodied voice of Teresa May. I’m not even exaggerating – it was as though the liver-lipped old trout was in the car with us, barking orders and shrieking instructions. It was terrifying: take the second Brexit, indeed.

Anyway, I immediately noticed something was wrong when we ended up following a tram down the tram lines. That’s generally a bad sign. Nevertheless, buoyed by Paul’s strict instruction that the Sat-Nav is always right and ‘you always panic driving in cities‘, we ploughed on.

For an arresting moment we found ourselves trundling through a Christmas market in the car – I could have reached out and grabbed myself a hot chocolate as we drove past to calm my nerves – before the Sat-Nav sent us down a tiny cobbled street. Clearly, something was amiss, but Paul was having none of it. We pootled on for another half an hour on possibly the most scenic city centre tour you’ve ever seen outside of one of those lurid double-decker scenic busses before I finally pulled us over in someone’s garden and told Paul to check the settings on the Sat-Nav. Yep: he had it set to ‘avoid major roads’, which, as you can imagine, adds an extra layer of fun and frolics onto driving an unfamiliar car in an unfamiliar city, on the wrong side of the road, on the wrong side of the car, in ice and heavy fog. Oh how I laughed as I spun the car wheels on the icy grass before we made our way back to the motorway. You could see the car-rental place from the sliproad of the motorway as we joined.

Ah well. You live and learn. Once we were on the open road we were straight up to 75mph (their speed limit) despite the freezing fog. Why? Because everything just works perfectly. There wasn’t a flake of ice on the road, there wasn’t a ten mile tailback of beeping cars and lorries, no, everyone just sped along in uniform civility. It was lovely. It puts us to shame, it truly does. I know we’re not an alpine country and thus people aren’t used to driving in wintry conditions but for goodness sake, they shut the A1 in both directions if I leave my freezer door open too long. Pah.

One thing we learnt about the Swiss as we drove along their motorways: they fucking love getting their cocks out in the motorway toilets, and I don’t mean for a piss. I don’t like to be crass but for goodness sake, let me have a piss in peace without helicoptering your penis at me or wanking away like you’re beating out a carpet fire. I half-expected to be arrested for suspicious behaviour because I wasn’t cottaging. Don’t get me wrong, I’m no prude, and if the smell of twenty years of splashed urine and 10,000 lorry driver farts gets the blood pumping for you then all the very best, but please, try and be a bit more discreet.

Anyway, we left after five hours – just enough time for the ammonia on the floor to burn through my jeans at the knees.

As we drove towards Gruyère the fog seemed to melt away and Switzerland opened up for us – it was magical. Everything was frozen but, especially when bathed in the brilliant light of the winter sun, it shone. I wanted to walk in every forest, ratch down every street – and that’s really saying something when you consider what a fat fucker I am. You’d barely get a chance to admire the views of an ice-covered river when a hill would rear up and you’d get a load of chocolate-box cottages all glistening in the cold. I felt like I was in a chewing gum advert. Paul developed RSI from having to snap his neck this way and that as I exclaimed ‘oooh look at that‘ and ‘cor have you seen that mountain?‘ – luckily, we weren’t short of ice to put on it. To give you an idea of the beauty:

taster night fruit skewers taster night fruit skewers

We made it to our first destination, La Maison du Gruyère, in good time indeed. Now, as you might have guessed from the name, this was a factory manufacturing ball bearings. Well obviously not – it was a cheese factory. I love cheese, and I love Gruyère. I will cheerfully admit to having a semi as I climbed out of the car. I know visiting a Swiss cheese factory whilst in Switzerland is as obvious as visiting the Eiffel Tower whilst in Paris or being happy-slapped for your mobile in Hull, but I don’t care. We paid the very modest entry fee and were given quite the phallic-looking handset that would translate the entire thing for us so it sounded like Paul’s sister patronising us the whole way around. It was quite distressing. However, what made up for that was the fact you’re given a packet of cheese as you enter. My kind of museum!

The displays were informative – the right mix of cutesy-poo (meet Cherry The Cow!) and blistering factory facts to keep you going. Don’t get me wrong, don’t plan a holiday around it as we were done in half an hour, but as cheese factories go, it was great. I say this from the perspective of someone who has a cheese factory you can tour a mere ten miles from my house. I know, truly my life is decadent. There’s a comedy picture of me biting into a cheese wheel that’s only just wider than Paul’s waist but as my chins are cascading down my coat like a melted church candle, I shan’t be posting it. We stopped into the well-appointed gift shop in the hope of buying me a hat but were thwarted yet again by my giant elephantine head. I don’t understand it, you know – I look in the mirror and see a normal sized head but I can’t get a single hat to fit me without being skintight and giving me a permanently startled look. I’d kill to be able to wear a tricorn hat with panache, like Inspector Javert. More like Fatbear, am I right? Sigh.

We did toy with having a tour around Gruyère but we had a lot to do and we had to return the car at 6pm, so culture was pushed to one side.

Next stop on our Car Trip of Cardiovascular Strain was a trip to a chocolate factory, which frankly, is like following up a large scratchcard win with a fantastic blowjob. I mean, it doesn’t get better than the words ‘unlimited samples of Swiss chocolate’, does it? At this point I had to push my car seat back a good few inches, and it wasn’t just my belly that was swelling. Cor! Turns out that the Maison Cailler was about a twenty minute drive down the road so off we went. Roadworks diverted us into an aerodrome which made for a startling moment or two as tiny planes beetled about around us but we were soon back on our way and, after navigating a proper hairpin bend on a very steep hill (what fun!) we were parked up and joined the queue for entry.

Well, whilst I hate to repeat myself, this was smashing too. Entry costs were minimal but the whole experience was well thought-out, interesting and interactive. We joined a group of six very obviously gay men (no need to peacock though, there were lots of knowing looks and laughter) (and actually, that would explain our eight blank faces when we got to the Frigor bit) (Frigor? Why I barely know her!) and were shown to the entrance. What followed was a good thirty minute walk around showing the history of chocolate, how it is made, the health benefits…I tried to look as interested as possible but what we all wanted to know was when were the free samples coming and would I be told off for bringing a suitcase? We rounded a corner and there it was – all sorts of different chocolates just out for the tasting.

Naturally, being British, we showed remarkable restraint, nibbling and coyly picking up just-one-more in case they decided we were obscene and shut the door. Hilariously though, there was this big gym-bunny of a man there with his girlfriend. Now, he was not that nice, toned gym-boy that you see around but rather he looked like a bin-liner stuffed with rugby balls. His Littlewoods crop-top positively strained over Wotsit coloured muscles and I’m sorry but he had the haunted look of someone who knows that he’ll be injecting steroids into his cock later that day. ANYWAY. When he saw eight burly men come mincing barrelling around the corner he immediately started puffing out his chest and strutting around like Barry Big Bollocks. You know what I mean?? That thing blokes do when they try and make themselves look hard and important? Pffft. Top tip mate: no-one was impressed, you were trying to intimidate eight gay blokes who each had a better spread of facial hair than you and it’s impossible to look macho when you’re standing in a chocolate factory shovelling dainty wee raspberry truffles into your gob with your giant shovel hands, you absolute fucking melt.

His girlfriend had the good grace to look embarrassed.

We all tittered and laughed at the little machine that pooed out the chocolates (no other word for it) and then Paul and I added our own bit of humour onto their massive interactive computer board which asked the question ‘When should you enjoy chocolate?’

img_20161216_122548

That’ll be us off the magazine list, again. Ah well. At least our effort was better than Baba Babayev’s on the right there though – what a kiss-arse. Bet that wasn’t just cocoa on her lips.

Next stop on our whistlestop tour of Things That Sounded Good When Pissed was the town of Montreux, a mere forty minutes or so away. Now we absolutely didn’t have time to tour the town and do it justice so we decided to visit the absolutely stunning Château de Chillon, down on the shoreline of Lake Geneva instead.

img_20161216_140035

The castle was the inspiration for the castle in The Little Mermaid, which is a handy link as Paul models himself on The Little Mermaid’s villain, Ursula. We were so lucky – perhaps because it was Christmas or because it was overcast I don’t know, but we almost had the place to ourselves.

This was very fortuitous indeed. Why? Because the castle – whilst breathtakingly pretty and wonderfully kept – is a series of staircases, ladders and steep climbs to get right to the very top. With both of us busy turning eight kilos of chocolate and cheese into poo and heart disease, this was perhaps not a good idea. The fact we were by ourselves was most welcome as it meant we weren’t pressured into climbing at anyone else’s pace and we were able to stop and catch our breath, shock our hearts and discreetly vomit into nearby suits of armour. Any passing staff must have thought we found the info-boards particularly absorbing (and, to be fair, they were) but actually, it was just us bent double trying to resaturate our blood with oxygen.

taster night fruit skewers

You know what made the place great, though? It took us a while to twig and then we realised – there wasn’t masses of taped-off areas and warning signs to mind your head and stop smoking and don’t run and don’t use flash photography. We weren’t being told off at every opportunity and it was most refreshing, even if I did curse loudly when the top of my head scrapped along the ceiling. Oh and I did fall down a pretty much vertical flight of stairs when I started can-can-ing my legs as I came down, which in turn made Paul exclaim that I ‘looked like the Phantom of the Opera, only more a fat c*nt’ (we had the place to ourselves, I remind you), which then made me laugh and lose my footing. I landed on my giant gelatinous arse and was fine, don’t worry. Silly Swiss: I might recommend a warning sign for ‘acts of theatricality’. We made sure to take plenty of photos to add onto our iCloud to never be seen again and then made our way out.

There was a photo opportunity as we left with a little pier that strutted right out into the lake and we made for it only to be rudely pushed out of the way by what I think were the same horde of tourists that had prevented us getting a decent picture at the Broken Chair a few entries back.  First they would each take a picture of one of them standing on the pier, then they’d swap, then they’d change the lens, then they’d shriek hysterically and change the lens again. We waited patiently for a good fifteen minutes before (conscious of the fact I’d parked the hire car in a place I wasn’t entirely unconvinced wasn’t a coach park) I invaded their photographs and walked right along that pier. It made for a good set of photos – me posing merrily with my little Swiss flag, eighteen disgruntled and sullen faces just moving out of shot. Pfft. I’d post the picture but the rage-blood seeping from my eyes somewhat ruins it.

We bought some chocolate from the gift-shop and made our way back to the car. At this point I was very tired so Paul was under strict instruction to keep talking to me and not to let me fall asleep. Naturally, he was asleep before I turned the indicators off to get out of the car park. It was a long drive home – I had to keep stopping at the rest areas to have a man-made protein shake rest. We were less than half a mile away from the car drop-off area, all ready to head back to the hotel, when the stupid Sat-Nav suddenly thought we were in entirely the wrong place and set us down a slip road onto a different motorway, adding an extra 30 miles onto our trip. I hate them. I really bloody hate them. My loud swearing woke Paul up whose first words were ‘you should have woke me up’ which, as you can imagine, really made me chuckle. I could have undid his seatbelt, opened his car door and sent him tumbling out onto the motorway at 75mph and he’d still be fast asleep, doing tiny little cheesy farts all the night long. BAH.

By the time we did make it back to our room it was all we could do to remove the tiny Toblerone they placed on our pillows before falling fast asleep. All that mountain air, see. I promise to talk to you about Bern on the next entry, it really was a terrific place, but look, we’re almost at 3,000 words and I’m just sure that means most of you will have buggered off by now. If so, shame on you, least not because you’ve missed out on the recipe for these taster night fruit skewers!

taster night fruit skewers

to make taster night fruit skewers, you’ll need – well, duh:

  • a couple of tangerines
  • a box of raspberries
  • a few kiwi fruits
  • a fresh pineapple
  • black grapes, black as your soul
  • cocktail sticks – ours aren’t anything fancy, we bought them for the burgers we do, you get 100 on Amazon for about a fiver, or you could use any old shite you have sitting around the house, no need to fret!

to make taster night fruit skewers, you should:

  • now come on, really
  • no, really?
  • OK, well, assemble as above
  • I cored the pineapple, cut it into rings and then into chunks, but you can buy chunks in juice, remember to syn it though
  • I made the kiwi stars by cutting thick slices of kiwi and then, wait for it, using a star shaped pastry cutter – I know, someone call Alfred Nobel, because we’ve got a bloody genius here
  • that’s it

Two things to remember:

  • Captain Gunt suggests that you could serve this with a melted Freddo bar or something to dip in – but seriously, come on, just eat your Freddo; and
  • not a fan of the fruits above? Well, you’re homophobic and I’ll thank you not to read this blog. Oh THOSE fruits, right right – no, just swap them out for anything you like, I don’t mind, I just like the pretty colours!

Want more taster night ideas? Love picking other people’s cat hair out of your teeth whilst you choke down a sliver of cottage cheese quiche? Then click the buttons below and be inspired!

snackssmall tastersmallnaughtyfooddrinkssmallbbqsmall

Goodnight all!

J

Standard

Posted by

Posted on

January 4, 2017

Posted under

lunch, one-pot, pulses and grains, recipe card, savoury snacks, snacks, soup, syn free, vegan, vegetarian

golden lentil and barley soup – look, I tried, OK?

I don’t think I’ve ever put a less appetising picture up on this blog (actually, that’s a fib, remember the time we accidentally uploaded a giant pulsing sphincter? No? Click here for that, it’ll open in a new window) than this golden lentil and barley soup. It looks like someone has already taken a stab and eating it and then chucked it back up for someone else to have a go with. But see, we do like to support our vegan members, with their milk-white skin and gunshot eyes, and this looked so appetising on the blog where I took the recipe from. Usually I take a recipe and adopt it for Slimming World myself but this required no changes so full credit and awe go to yupitsvegan. I’m sorry that I turned your delicious looking golden lentil and barley soup into a pile of tramp’s truffles.

Anyway, just a short entry tonight because it’s our anniversary. We’ve now been married six years. We both thought it was five as it happens and were shocked when Facebook’s lookback feature showed us both relaxing in the double bath six years ago. I mean, where does the time go? In May it’ll be our proper anniversary from when we started, how can I put this delicately…fucking, and that’ll be ten years. Ten years and we’re still dead romantic – only the other morning Paul murmured lightly, as I cuddled him, that I was ‘like a George Foreman grill’ – I keep him lovely and warm. D’aww. I recounted this whimsical tale of love into our facebook group only for someone to say ‘Is it not because you drip when he puts his meat in?’. Brrrr. Although it made me laugh, it does show a lack of understanding of the general mechanics of our shenanigans. Mind the romance doesn’t just flow one way, you know, look at the heartwarming notes I leave in his lunchbox (and I apologise for the naughty word, it’s rarely used on here):

15800214_10155862434106509_8151582915147000597_o

If that offends you, it shouldn’t, it definitely says fat aunt. Promise. *cough*

Now, rather than leave you unsatisfied and wanting more, I’m going to put the very first entry from our honeymoon book on here – it deals with our wedding day! The glitz. My writing style has changed somewhat since then but hopefully you’ll still get a taste of us…

Way back in 2009, also at Disney, I proposed to my stout little barrel of a man and he gleefully accepted. I think it was the fact we were in the middle of a lake and I’d be watching an awful lot of Dead Calm recently that hastened his positive reply. We got honked at by a passing Disney ferry whose inhabitants thought I was down on my knees doing something other than proposing. The nerve. I mean, it wasn’t Christmas! Zip forward to 3 January 2011 and the day before our wedding. Well, the glamour started right from the off with one of the cats deciding to do a dirty protest in the car whilst we ferried him over to my sister to look after. You’ve never seen someone wind a window down quicker than us that day, and because the cat is fearless and would have jumped, he stayed in his messy box all the way to my sisters. It was with tears in our eyes (and Vicks under our nose) to see our pooey little furball depart, but there you have it.

We spent the evening before the wedding in our first treat, a room at the Hotel du Vin in Newcastle. You may think Newcastle is purely the land of bust noses, bare flesh and broken hymens, but we’re more than capable of bringing the class, and this is one of the nicest hotels in the area. I mean, it has a cigar bar attached, for heaven’s sake. Our very first surprise of the honeymoon? We were upgraded to the best suite in the hotel, the Dom Pérignon suite. It was bloody beautiful. It’s the honeymoon suite and I was overjoyed, especially as I had only paid £68 for the room through my shrewd discount plans. A massive thank you to the staff of the beautiful Hotel du Vin, that’s for sure. The room had two bathtubs in the living room, and I think we were in the room for a grand total of two minutes before they were full of bubbles and we were laid in them watching Deal or no Deal on the giant TV and feeling like kings. The bed was wonderful too – it felt like it was 9ft wide – I could lie in it, stretch myself out and STILL not touch the sides. Sometimes I wonder why Paul married me.

There was NO late-night prodding awake with a bed this big.

After a meal on the Quayside and a romantic stroll back to our room, we settled down to sleep – our last night as bachelors! Here’s a sweet fact for you – in all the time we’ve been together, we’ve never had a night apart. A good start to the marriage methinks! And so…to the wedding!

We had decided a couple of months previously not to have a big do at all, and just a small registry office affair followed by a good dinner. I wish I could say it was for any other reason than the fact we’re both terribly selfish and Northern and thus the idea of spending money to facilitate other people having a good time appals us. Plus, I wanted to avoid the horrid old clichés of a civil partnership. Bah! I’m not casting aspersions on anyone else’s wedding but it suited us to have a small, tidy, manly do. So we did. Well, we did toy with the idea of dressing up like the sisters from Shakespear’s Sister’ Stay video but we were talked out of it. We became Husband and Husband in Newcastle Registry Office, presided over by an official who was the spit of Annie Lennox, and watched over by our immediate family and good friends.

The deed is done! Don’t you think the Argos CD player really sets off the room? 

As an aside, my gran was there, and she’s brilliant – despite being 87, she’s thoroughly accepting of our relationship and is always asking after Paul when I call up. I mean, there are limits to her acceptance – I didn’t dare explain what fisting was when she asked me one day after seeing the word on my phone (I might add, someone had texted it in a joke to me, I’m not that FILTHY). It still felt a little bit too formal for me, as I’m not used to someone addressing a suit-clad Paul without adding ‘the defendant’ afterwards. We decamped to SIX, the faffy little restaurant on top of the Baltic. It’s very posh. NOW, we’re not a posh lot, and class McCains as a ‘fancy potato style’ but you have to let your hair down once and a while, even if (as is the case in all the males at the table) you don’t have any.

So, a suitably lovely meal was had, only enhanced by the snotty waiter looking down his nose at us and rolling his eyes when I ordered a couple of bottles of reasonably-priced champagne. Well, reasonably priced for them – paying £65 for a bottle of fizzy cat pee gave me such a cold sweat that I had to excuse myself to the bathroom to calm my shakes. My nana, bless her, didn’t really fancy anything on the menu (I can’t blame her, I’ve never heard two bits of chard, a sliced tomato and a bloody drizzle of balsamic vinegar described as a French Salad before) but they were very good and cooked her up her own individual meal. I stopped short of asking them to put a glass of Banana Complan on ice, though.

After the meal, we went to the pub for an hour, then everyone dearly departed, and our honeymoon officially started. Yes! Back to the flat to really put the bed through its paces by er…putting the suitcases on it and tipping our wardrobe into them. I have to say, it wasn’t the first type of packing that I had planned for the wedding night. We slept, butterflies in our stomach (SIX would call them an amuse bouché) and in no time at all, we were in a taxi being bellowed at by a rather brusque taxi driver who wanted to know the far end of a fart and when it came from. Honestly. I spent the entire trip to the train station trying surreptiously to take a photo of his face on my phone so I would be able to identify who had burgled our house when we were away. Thankfully, that didn’t arise.

Straight onto the train, into the first class carriage (where you too can travel in style with an extra doily and a few crappy biscuits) and we were disappearing over the Queen Elizabeth bridge, saying goodbye to Newcastle from the bridge. Now here’s a tip for you. If you’re coming into Newcastle (or indeed leaving) from the South on the train, don’t look slackjawed to the right and admire all the bridges, but instead, look on the other side of the river, up the Tyne. As you cross the bridge, there’s a little wasteground, and it’s always full of men out ‘badger-hunting’. Yep – whereas most people are taken by the beauty of the moment, Paul and I spent the first minute of our honeymoon journey playing ‘Count the Cruiser’. What larks!

In no time at all, we were in London, our seedy capital. Kings Cross is lovely, yes, but in no time at all we had tubed our way to Victoria and onto the Gatwick Express, heading for the giddy heights of the Gatwick Hilton. What a place! After spending seven years navigating to the hotel from the train station (seriously, we spent so much time walking there that I almost gave up and set up base for the night), we were checked in by a clearly-couldn’t-care-less-customer-divvy and in our room. Grim. I’m not a hotel snob but after spending the night in the Hotel du Vin only two nights ago, the Hilton’s tired brown sheets and tiny bathroom didn’t exactly enamour the soul. After spending only a moment admiring the view (car-parks are just SO fantastic to gaze at), we trekked back to the airport and checked in super-early (is it still Twilight Check-in if it is during the day?) with Virgin Atlantic. We had pre-booked our seats in the bubble but no sooner had we dumped our bags than the lady behind the counter told us we had been moved. Argh! I was too busy trying to work out the best way to hide her body to take in what she was saying, but – hooray for thedibb – when I was back at the hotel I checked online and we were RIGHT at the front of the bubble. Get in! Not only do I get to look down at the cattle-class, but I was going to be on first-name terms with the pilot. OK, maybe not THAT close. And we don’t look down our noses at anyone…well…not much.

We spent the evening in the hotel, watching a home movie entitled ‘Britain’s Fattest Man’ starring Timothy Spall. It was very good, even if we didn’t feel a shred of shame stuffing a pork-pie into our gob the very moment he had his fat chopped off. A good nights sleep was had, and we were ready for day 1.

God, I’m absolutely itching to rewrite that, you know. Not least because it refers to my nana in the present tense instead of the past and I’m fairly sure she’s still Voldermort-ed. However, if you’re a glutton for punishment and you like sentences that never end and punctuation used like confetti, you can buy the rest of the honeymoon book right here.

Right, let’s deal with this delicious looking dinner, shall we? Mmmm! Get ready to gag! No I’m kidding, it looks like slop, but honestly, it tastes bloody lovely! Please don’t be put off!

golden lentil and barley soup

Look, to make up for that picture, here’s some similarly coloured cats:

d8pcbgk

Why can’t we have a cat like that one in the middle? Why must we have one that licks his knob all day and another who scrapes her minnie-moo on the floor? For fucks sake.

to make golden lentil and barley soup, you’ll need:

  • a few sprays of olive oil – frylight if you must, but just don’t do it to yourself
  • one large onion
  • 4 cloves of garlic or a reet good sprinkling of the powdered stuff
  • a fiddler’s thumb of fresh ginger (about an inch) (or powdered, about half a teaspoonful)
  • as above, but with fresh turmeric – can’t get fresh turmeric? Don’t shit the bed – just use about 1/2 teaspoon of the powdered stuff, I’ll never tell)
  • one large carrot – thinly sliced
  • pinch of cumin and the same again of coriander – don’t like your meals with cumin? Then don’t get so excited! Hello? Is this thing on? Hello? Nah, leave it out if you’re not a fan
  • 1200ml of decent vegetable stock / bouillon
  • 150g of red lentils
  • 100g or so of dry pearl barley
  • two tablespoons of tomato puree
  • salt and pepper to taste

You know what’s coming don’t you? You just know it! Buy a mincer to take care of your garlic, ginger and turmeric in no time at all. Also, chop your carrots quickly and uniform with a mandolin slicer, but for crying out loud, be careful. I’ve got fingers like snapped Matchmakers thanks to mine.

to make golden lentil and barley soup, you should:

  • chop up your onion nice and fine and then cook off in a bit of oil in a heavy-bottomed pan
  • once the onions have softened, add the minced garlic, turmeric and ginger and stir on a medium heat until everything smells lovely
  • add the coriander and cumin together with the chopped carrot and continue to cook gently until everything has softened a bit
  • add the pearl barley, lentils and stock – bring to the boil then drop it to a simmer

A quick note: take the time to wash the pearl barley more than a few times. Stick it in a sieve, get the hot water running, and rinse rinse rinse. Stops it going gloopy. Right, where were we…

  • cook uncovered for about 25 minutes until the lentils and pearl barley are cooked through – longer is fine, but you might need to top the liquid off with more stock
  • add the tomato paste and salt and pepper to taste, stir through and cook for another minute or two
  • serve – oh we added a drop of chilli sauce on the top but that’s up to you, see

If anyone asks, just reassure them that it’s hearty and delicious and syn free!

Looking for more soups? Try these!

Looking for more recipes overall? Click some buttons!

vegetariansmallfakeawayssmallpastasmall sausagessmall  seafoodsmallbreakfastsmall

Enjoy!

J

Standard

Posted by

Posted on

October 26, 2016

Posted under

low syn, lunch, recipe card, savoury snacks, snacks, taster ideas, vegetarian

droptober recipe #17: sweet potato bread buns

I’m almost loathe to post this recipe for sweet potato bread buns because I’ll invariably get a load of people messaging saying ‘but you can have an Aldi bun for a few syns more’ blah blah. Listen, I know that. But why buy a car when you’ve got two legs? Sometimes it’s nice to mix things up and with soup season just around the corner, these make a nice side dish for whatever slop you turn your veg into. Plus, I don’t know about you but we always seem to have three or four sweet potatoes rolling around in our drawers. It’s like being haunted by a vegan – but how would you even go about telling whether a vegan is a ghost? God knows they’re pale, wispy and whining in real-life. I’m kidding. Please don’t write me letters, save your strength.

Things are still grim in Chubby Towers. Paul’s been flirting with a cold for a good couple of weeks and now it has really got him in its snotty grip. He’s currently lying on the sofa sniffing and snorting like Kerry Katona on giro day. He’s coughing like a 200-a-day-smoker/his mother and I could toast marshmallows on the end of his nose. You know that bit in the movie Misery when Annie Wilkes gets walloped with an iron at the end of the movie? That’s Paul. He’s in a bad way. Now, traditionally, we’d rattle off a few jokes about man-flu but I’ve always thought that was reductionist and mean. He’s just a soft arse. I’m sore because as a result of him snoring like an idling bus all night and keeping me awake and I’m tired of running around getting drinks and decongestants and nasal sprays and tissues – oh CHRIST the tissues, it’s like I’m living in the bedroom of the type of blokes who get stung by online vigilantes – and I’m reaching the end of my goodwill. I’d make a shit nurse, I’m not going to lie. Anything more than applying a plaster and I’d be pressing a pillow into their face and turning off the alarm bells.

There was a brief shining glimmer of goodness in my day, however. I was given a free packet of crisps by someone in town today. Because I’m naturally cynical, I spent five minutes looking around for the hidden camera crew who would be recording me opening the packet only to get a face full of bees or something mean. Also, because I’m naturally morbidly obese and a greedy bastard, I spent another twenty five minutes going around and around to the various people until I had seven free bags. I know, what a cad. Paul and I were once in the Metrocentre (the glitz! the glamour – it never ends because it never fucking begins) and there was a team of 12 people handing out bags of those Milky Way Magic Stars. We sharp calculated that if we split up we could grab 24 bags. Even better, once I had removed my glasses I could grab another twelve and better yet, when Paul put my glasses on, he was able to get another 12, even if he could see through time whilst doing so. Then, swap coats to repeat the whole affair, then go and sit in McDonalds for half an hour and go around again. In total we ended up with about 150 bags of Milky Way Magic Stars. This was back when we didn’t drive so it meant an hour trip home on the bus with more chocolate than any fat bloke has a reason for having but we definitely won that day.

I can tell you now though – the allure of so much free chocolate is sharp lost after the 35th bag. We were eating those bloody stars for days and even now the sight of that four-eyed twat the Milky Bar kid fills me with absolute rage. I swear I was reclining in the bath when one of those damned stars floated out of my belly button.

Paul just chimed in from the sofa to add his best freebie story, so let me treat you to a wee bit more. Back when Paul was a nurse he, and a lot of his colleagues, were often treated to fun little freebies from drugs companies and other parasites. Mugs, laser pointers, chocolates and, somewhat inexplicably, a doorbell. Because nothing says ‘best treatment for a prolapsed arsehole’ like a doorbell. Anyway, he was super excited to be given a face towel roughly the same shape as a little pink pill. The gimmick being that you added water and the whole thing would rehydrate, unfurl and give you a charming, if somewhat moist, free towel to wipe your sweaty face with. So enchanted by this fabulously pointless gimmick that he saved this little towel-pill until he was at the gym and, with a proper flourish, rehydrated it in the changing room gym. Here’s the thing: it was a great towel, but it’s hard to look debonair and stylish when you’re wiping a towel with VAGISIL imprinted across it in pink Mistral font. No wonder he doesn’t bother with gyms now, the poor bugger is scarred.

Right, let’s get to the bread, eh?

sweet potato bread buns

to make sweet potato bread buns, you’ll need:

  • 300g of sweet potato – either leftover mash or some that you’ve made especially – just peel, boil and mash it as smooth as possible
  • 450g of plain flour (this makes enough for 18 buns – they’re not huge but they’re tasty – so this works out at 4 syns each)
  • 1 packet of yeast (1 syn – but damn it if I’m splitting that between 18)
  • 120ml of warm water
  • good pinch of salt and pepper
  • one egg
  • poppy seeds – if you want them, syn them, but you don’t need to add them onto the top

to make sweet potato bread buns, you should:

  • either in a big bowl or a stand mixer with a dough hook (we use our Kenwood Chef, we love it), add the flour, mashed sweet potato on one side, water on the other, yeast on another side and get bloody mixing
  • once it’s starting to come together, add the salt and pepper
  • you want to mix it until it’s all come together nicely – you want it smooth and elastic
  • drop it into a bowl and cover with clingfilm – then leave to double in size for about an hour in a warm room
  • take out, divide into 18 small balls, put onto a non-stick baking tray or two
  • cover with clingfilm and allow to double again for an hour
  • crack and beat the egg then smear the top of each bun with good old beaten egg
  • cook in a pre-heated oven for about 25 minutes on 180 degrees
  • serve – it’s just that easy!

Like I said, you could buy your own, of course, but if you’ve got leftovers, why not make these? EH? Click the buttons below for even more inspiration!
poultrysmallbeefsmallporksmalllambsmall
Cheers all!

Standard

Posted by

Posted on

October 24, 2016

Posted under

fakeaways, greek, low syn, lunch, recipe card, savoury snacks, snacks, taster ideas, vegetarian

droptober recipe #16: greek garden omelette

Well, Droptober’s 31 recipes fell over, but hey, let’s at least try and aim for 20 eh? Shit or bust! Tonight’s recipe is greek garden omelette, but let’s dwell for a moment.

Ah, autumn. It’s finally arrived. You know how you know autumn has truly arrived? It’s really very simple – it’s not the leaves on the trees turning russet and golden, nor is the first icy chill in the air oh no, it’s when you first spot the first sharing of ‘MUSLIMS WANT 2 BAN THE POPEYE LIKE IF U THINK THIS ISA DISC RACE IGKNORR IF U H8 SIVILISA SIEVEISEYELISAT EVRY1′ on facebook.

cuhbpwawsaejy7o

Just for the record, this is a disc race. The word you’re aiming for is a disgrace, as in ‘I am a disgrace to my peers for sharing this hateful nonsense’. Twat. I’ve had my first one already this year. Don’t share hatred!

Anyway, not sure where that little nugget of anger popped from, as I’m actually feeling quite laid back. Apologies that we stopped posting for a bit but well, we’re busy folk and plus, in all honesty, it’s hard to eke out 700 exciting words about doing very little thanks to ear infections, busy work and house problems. Some random thoughts, though.

Paul pointed out that I must have come across as a right unsympathetic arse with the guy who comes around and cleans my car, and not least because the poor sod has to sit in a mist of my farts, Haribo wrappers and chest hair whilst he scrubs away at my accellarator and that weird second pedal in the middle that I have no idea what purpose it solves. See, he was supposed to be at ours last weekend and failed to turn up, leaving me seething and sighing dramatically to the point where Paul diagnosed me with COPD and put me on an oxygen feed. He texted a few hours later to say his mother had been taken into hospital, hence no contact, and I said it was fine, no worries, we can re-arrange. See, I’m not a complete bastard.

If I was a bastard I’d have driven to the hospital, unplugged her life-support and plugged in the little handheld hoover so he could give my gearstick bag a good suck, but I digress.

He turned up yesterday full of unnecessary apologies and set to work. I asked if he wanted a coffee to keep him warm then promptly forgot about it and went about my business. It was only after spotting him looking forlorn across the garden that I remembered and hastened out with a piping cup of the Blue Mountain that we keep for guests. However, Paul pointed out afterwards that I’d served his coffee in one of our Modern Toss cups, namely the one that says “I don’t feel like turning up for work today, so fuck off”. I hope he doesn’t think I’m being passive aggressive and refuse to polish my rims. Just once I’d like a workman to leave this house and actually want to come back.

Ah! You know how people always say there’s never a policeman around when you need one? Well, after five years of driving, it finally happened for me – I was beetling along a dual carriageway in the right hand land, unable to pull over into the left lane as there was slower traffic, when some wankstain in a Vauxhall Insignia came so far up my arse that I almost unrolled a condom as force of habit. He was doing the usual – giant hand gestures, yelling incoherently, wanker signs – I’m not sure if he had realised that I literally couldn’t go anywhere as my DS3 was unlikely to squeeze into the passenger seat of the Fiat 500 to the left of me. Cock. I drove on, keeping to the speed limit and putting my hand on my chest and shaking my head ruefully in a very British ‘what am I like’ gesture, which only served to make him angrier.

However, once I could get over, I did move over, not least because his face had turned into a mewling over-ripe strawberry at that point and I didn’t want the fucker to stroke-out and need mouth to mouth by the side of the road. I rather expected his lips would taste of sweat, cheap cigars and Lynx Atlantis. He sped past, gesticulating all the while, and I promptly forgot about him, the very same way I imagine all his friends and family do at a social occasion. Five minutes later, at the end of the dual carriageway, there he was getting talked to by a very butch looking policeman. Ah, lovely. I made absolutely damn sure I slowed down as I went past but didn’t manage to catch his eye – however, he saw me on my fourth trip around the roundabout, and I was sure to give him the tinkliest, most coquettish little way as I trundled past.

Finally, it’s been a while since we discussed the neighbours and that’s for a good reason – all bar one have turned into decent human beings. We still have the one who won’t talk to us unless he’s blowing spittle in our face and complaining about our cats, but then he’s also the one who bemoaned to our other neighbours that having two gay men on the street would bring the house prices down, so you can imagine how much we value his opinion. Everyone knows that having a gay couple only improves the house prices because there’s no screaming children kicking about and well, we’re hardly likely to put a trampoline on our immaculate lawn, are we? The stupid fart.

Anyway, the reason I mention the neighbours is that we’re coming up to Christmas cards buying time (sorry!) and we still haven’t solved the problem from last year – we realised that we have a couple called Pat and Les on the street but no fucking clue which is which. I know it doesn’t matter but I hate not knowing, not least because they’re decent people and always make a point of saying ‘morning James, you’re looking slim’ or “sorry Paul, can you come and retrieve your car, a slight gust has blown it into our lobelia”, to which I can only stutter and say ‘howdo…my love’ or similar. Is it Patrick and Lesley? Patricia and Les? Bah. At least we know what to call the homophobic neighbour, although, as he’s deaf, he’s must be mystified as to why we call him a Count as he walks past scowling at our cats.

Speaking of gardens, let’s get to the greek garden omelette I promised you earlier!

greek garden omelette

to make greek garden omelette you will need:

  • 10 eggs
  • 1 large red onion, cut into wedges
  • 3-4 tomatoes, cut into large chunks
  • 130g reduced-fat feta cheese (2x HeA)
  • handful of black olives (about 20-ish – 4 syns), sliced in half
  • handful of rocket leaves
  • pinch of salt and pepper

The joy of an omelette is that you can customise it however you want – throw in some sliced sausages, ham, mushrooms, cigarettes or a small motor car. It’s YOUR dinner. This makes enough for four. You will need a pan that can go into the oven – we use this, but you can get cheaper!

to make greek garden omelette you should:

  • in a big bowl, whisk together the eggs with the salt and pepper
  • preheat the grill to high
  • heat a large frying pan over a high heat and add some oil (use one of these and save your pans!)
  • chuck in the onions and fry for a bit until softened and beginning to brown
  • add the olives, rocket and tomatoes and cook for a few minutes more until softened
  • reduce the heat to medium and pour in the eggs – stir frequently whilst they’re still runny and until the mixture is half-set – this will only take a couple of minutes
  • sprinkle over the feta cheese and put the pan under grill and cook for 5-6 minutes until puffy and golden

Enjoy! For more ideas, click any of the buttons below!

poultrysmallbeefsmallporksmalllambsmallfakeawayssmallpastasmallvegetariansmall sausagessmall  seafoodsmallbreakfastsmall

J

Standard

Posted by

Posted on

October 11, 2016

Posted under

breakfast, desserts, low syn, lunch, recipe card, snacks, sweet snacks, taster ideas, vegan, vegetarian

droptober recipe #11: peanut butter and caramelised banana toast

Just a recipe for peanut butter and caramelised banana toast tonight as we’re too busy putting our Musclefood box away and farting on with our new TV. See, this would be one of those days when we just wouldn’t post but because we’ve committed to this Droptober thingy, I feel like I can’t let you down! Breakfasts on Slimming World are either oaty affairs, a bit of fruit or that bloody fry-up picture which has been haunting the lifeline journal since time immemorial. Peanut butter is one of those things which sounds like it should be full of syns and, fair enough, it’s not syn-free, but as long as you’re sensible and don’t slap it on like Jordan slaps Canestan on her minnie-moo, you’ll be fine. 1 level tablespoon is 4 syns which you can easily spread between the two tiny Shreddies-sized slices of bread that Slimming World allows as your HEB.

peanut butter and caramelised banana toast

to make peanut butter and caramelised banana toast, you’ll need:

  • well I mean, it’s pretty obvious, no?
  • one banana
  • one tablespoon of peanut butter
  • whatever toast or thin you want to use
  • pinch of cinnamon if you dare

to make peanut butter and caramelised banana toast, you should:

  • toast your bread and get your peanut butter on it whilst it is hot – the heat will make it spread further
  • Christ, it’s a bad job when we’re having to eke out our peanut butter like we’re working from a ration book, isn’t it?
  • slice your banana and drop the slices into a hot, non-stick pan to toast them off and give them a bit of colour
  • top the toast

Just saying, but if you were feeling daring, you could totally add a drop or two of honey to the whole affair and really get going. If you’re going to be Lieutenant Anal about the whole syn thing, you should ‘technically’ syn the banana according to SW rules as it is cooked. However, it’s syn-free if you eat it uncooked and as you can see from the above, you’re doing nothing more than toasting it. If it makes you feel better, don’t toast the banana, just keep glaring at it until it toasts of its own accord. THAT WAY NO SYNS AM I RIGHT. Jeez.

If you’re looking for more breakfast ideas, click the buttons below and live like a Queen! We do have some canny overnight oats recipes!

sausagessmall  breakfastsmall overnight-oats

Remember to share!

J